KEGG   Pyrococcus sp. NA2: PNA2_0183Help
Entry
PNA2_0183         CDS       T01487                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PNA2_0183
Enzymes [BR:pyn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PNA2_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159886..161397
Genome map
AA seq 503 aa AA seqDB search
MRARVSILGVRTGHFTVFINPKDAEKWKLHPNDLVKIESGKRSIYGSVVIGDFIEEGSIG
LSQDILESYQFSEGETVFISPSGTPESVRYIKKKMRGEKLRKVEIETIVRDIVDRKLRNT
EISALVTAIEINGLDMDEIAALTIAMAETGDMLDIDRKPVMDVHSIGGVPGNKTNVLVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVLTNVTLSLDEIKRIVEKIGACLAWGGALNLA
PADDLTIHVERRLSLDPRGLMLASIMSKKYAIGSQYILIDIPTGKGAKVETIEEARSLGK
DFIELGKRLGQYVEVAITYGGQPIGYTVGPALEAKEALETLINGKGPGSLVEKALGLAGL
LLEMGGVAPKGLGKKVAREILESGKAYEKMREIIEEQGGDPNIKPEDIPIGDKTYTIQAP
TSGYVTGIDNRAITAIAREAGAPEDKGAGVRLHVKVGEKVKEGDPLITIHAESESRLDKA
IVLARRLEPIKIEGMVLQVLGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgagggtcagtatacttggcgtacggacgggtcattttacagtcttcataaat
ccaaaagatgccgaaaagtggaagttacatccaaatgatctcgttaagatagagagtgga
aaaagatctatatatgggagcgttgttattggagacttcattgaagaaggttcaatagga
ttgtctcaggatatattggagagttatcagttttcagagggcgaaacagttttcatttca
ccgagtggtactccagagagtgttaggtacataaaaaagaaaatgagaggcgagaagctt
aggaaggttgagatagaaacaatcgttagggatattgttgataggaagctgaggaataca
gagataagcgcccttgttactgcaatagaaattaatgggctcgatatggatgagattgct
gctctaacaattgcaatggctgaaactggagatatgcttgacatagataggaaacctgtg
atggacgttcacagcattgggggagtccctggaaacaaaactaatgttctcgtcgttcct
attgtagcggctgctgggttaacgatacccaagacaagttcaagagccataacgagtgca
gcaggaacagccgatgttgttgaggtactcacaaatgttacactcagtctggatgagatt
aaaaggatagtggagaagataggagcctgccttgcatggggtggcgctttgaacttggct
ccagccgatgatctaacaatccacgtggaaagaagattaagtttggatcctaggggtcta
atgctcgcaagtataatgtcaaagaagtatgccatcggaagccaatacattttgattgac
atccccactggaaaaggagcaaaggtagaaactatcgaagaagctagatctctcggcaag
gacttcatagagctaggaaagagattgggacaatacgtggaagttgccataacttatgga
ggacaaccaataggatacacagtcgggccagcgcttgaagccaaagaggctcttgagact
ctcattaacggcaaaggtccaggaagcttagtagaaaaagcacttggattagcaggatta
ttattagagatgggtggagtcgctccaaagggcttaggcaagaaagttgccagggaaatc
ctcgaaagtggaaaagcgtatgagaaaatgagggagataattgaagaacagggaggagat
ccaaacataaaaccggaggatattcctattggagacaaaacttacacgattcaagcccca
accagtggatatgtaactgggattgacaacagggcgataactgcaatagccagagaagca
ggggctccggaagataagggagcaggtgttagacttcatgtgaaagttggagagaaggtt
aaggaaggggatccattaataacgatacatgctgaaagtgagagcagattggacaaagcc
atagtgctggcaagaagacttgaacctataaaaatagaggggatggttctccaagtgctc
ggaaatatttaa

DBGET integrated database retrieval system