KEGG   Pyrococcus sp. NA2: PNA2_0216Help
Entry
PNA2_0216         CDS       T01487                                 

Definition
DNA-directed RNA polymerase subunit K
Orthology
K03055  
DNA-directed RNA polymerase subunit K [EC:2.7.7.6]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, archaea
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pyn00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pyn00240]
Genetic Information Processing; Transcription; RNA polymerase [PATH:pyn03020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(189904..190077)
Genome map
AA seq 57 aa AA seqDB search
MFKYTRFEKARIIGARALQIAMGAPILIDVPEGITPLDAAIMEFERGVIPITVIRPS
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaagtatacgaggtttgagaaagctagaattatcggtgcaagggcccttcagata
gcaatgggggctccaatcctgatagacgttcccgaggggataactccactcgatgcagca
ataatggagtttgaaaggggtgtaataccaatcacagtaattaggccgagctga

DBGET integrated database retrieval system