KEGG   Pyrococcus sp. NA2: PNA2_0216Help
Entry
PNA2_0216         CDS       T01487                                 

Definition
DNA-directed RNA polymerase subunit K
Orthology
K03055  
DNA-directed RNA polymerase subunit K [EC:2.7.7.6]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, archaea
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PNA2_0216
   00240 Pyrimidine metabolism
    PNA2_0216
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    PNA2_0216
Enzymes [BR:pyn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     PNA2_0216
Transcription machinery [BR:pyn03021]
 Prokaryotic type
  Archaeal type
   RNA polymerase
    Core subunits
     PNA2_0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(189904..190077)
Genome map
AA seq 57 aa AA seqDB search
MFKYTRFEKARIIGARALQIAMGAPILIDVPEGITPLDAAIMEFERGVIPITVIRPS
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaagtatacgaggtttgagaaagctagaattatcggtgcaagggcccttcagata
gcaatgggggctccaatcctgatagacgttcccgaggggataactccactcgatgcagca
ataatggagtttgaaaggggtgtaataccaatcacagtaattaggccgagctga

DBGET integrated database retrieval system