KEGG   Pyrococcus sp. NA2: PNA2_0304Help
Entry
PNA2_0304         CDS       T01487                                 

Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pyn01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pyn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
261488..262177
Genome map
AA seq 229 aa AA seqDB search
MVIFGLSRAIRRSSKNAIIAELKVYSPKYGDLLRGRDPLEILRKYERAGAVGISYITDPK
YFKGSFDFFRKLCQETELPVLRKDFIKTKEEIERTAEAGGSAILLITRLLKDDLPEFVDY
AREHGLDTLVEVHTLEELRIAIQTNSTMIGINNRDIGKLELDDGNVSLTEKLAPLIPDRY
VKVSESGISTIEDLKRALRVADAALIGTALMKAEDPEELLRKFVEVEIC
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatttttgggttaagtagagccattagaaggagttcaaagaacgcaattatagcg
gagctgaaggtctattctccaaaatacggagatcttctaagagggagggatcccctagaa
attttgagaaagtatgagagagccggagcggtcggaatatcatacataactgatccaaag
tactttaagggaagttttgacttcttcaggaaactttgccaggaaactgaattacccgtg
ctcagaaaggatttcataaagactaaggaggagatagagagaactgcagaagctggaggg
tcagcgatactactgatcaccaggcttctcaaagatgatttaccagaattcgttgactac
gcgagagaacatggattggacacactggttgaggtgcatacacttgaggaactcaggatc
gccatacagacgaattcaacgatgatcgggataaacaatagggacattggaaagcttgaa
cttgatgatggtaacgtttctttaaccgaaaaacttgctcctctaattccagataggtac
gtgaaggttagtgaaagcggcatatcaacaattgaggacttaaagagggccctaagggtt
gcagatgcagccctaattggaaccgccttgatgaaggcagaagatcccgaagagcttctc
agaaaatttgtggaggttgagatatgctag

DBGET integrated database retrieval system