KEGG   Pyrococcus sp. NA2: PNA2_0309Help
Entry
PNA2_0309         CDS       T01487                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PNA2_0309
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PNA2_0309
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PNA2_0309
Enzymes [BR:pyn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PNA2_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
265613..266779
Genome map
AA seq 388 aa AA seqDB search
MWFGKFGGQFVPETLVEPLKELEKAYKELKDDEEFNRQLEYYLKTWAGRPTPLYYAERLT
KKIGGAKIYLKREDLLHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGAL
LGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNAGSRTLKDAINEALRDWVATFEYSH
YLIGSVVGPYPYPVIVRDFQSVIGREVREQILEAEGTLPDAIVACVGGGSNAIGIFYPFV
KDRNVRLIGVEAGGKGLETGMHSASLNAGKIGVFHGMLSYFLQDEEGQIRTTHSIAPGLD
YPGVGPEHAYLKESGRAEYVVVTDEEALRAFHELSRTEGIIPALESAHAVAYAMKLAKEM
DRDEIIVVNLSGRGDKDLDIVLRVSNNV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcggtaaatttggaggtcaattcgttcccgagactttagttgagccgttaaag
gaattggaaaaggcatataaagaattgaaggacgatgaggagttcaacagacagctggaa
tactacctgaagacatgggccggaagaccaacccctctatactacgctgaaagattgacg
aagaaaattggaggggcaaagatatacctcaagagggaagatttactgcacggaggagct
cacaagacaaacaatgcaataggccaggcgttacttgccaagttcatgggaaagaccagg
ctaattgctgagacgggggccggacagcatggggttgcaaccgcgatggcaggggcattg
ctgggaatgaaagtcgacatatatatgggtgctgaggatgttgagaggcagaagatgaac
gttttcagaatgaagctccttggagcgaacgtcattccagttaacgctggctcaagaaca
ttgaaagatgcaataaatgaagccctcagagactgggttgccacatttgaatactcccac
tacttaattggttctgtagttggcccctatccatacccagtgatagtcagggatttccag
tcagtaattggaagggaggtaagggagcagatattggaagctgaaggaacgttgccagat
gcaatagttgcctgcgttggagggggaagcaacgcaataggaatattctatccatttgtt
aaggataggaatgtcagactcataggagtagaggcgggtggaaaaggcctcgagactgga
atgcattcagcatccctaaacgcagggaagatcggagtattccatgggatgctaagctac
ttcctccaagatgaggagggacagataaggaccacccacagtatcgcccctgggttagac
tatcctggagttggacccgaacatgcctacctaaaggagagtggaagagcagaatacgtg
gttgtaaccgatgaagaggcactaagggcatttcatgagctatcaaggactgaggggata
ataccggccttagaatcagcccatgctgttgcatatgcaatgaagctggccaaggaaatg
gacagggacgagataatagtcgtcaacctctcagggagaggggataaagatcttgatata
gttctcagggtgagcaacaatgtttga

DBGET integrated database retrieval system