KEGG   Pyrococcus sp. NA2: PNA2_0442Help
Entry
PNA2_0442         CDS       T01487                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PNA2_0442
Enzymes [BR:pyn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PNA2_0442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
371934..372815
Genome map
AA seq 293 aa AA seqDB search
MKLDVICMGNLNYDIVFLMERFPGIHEKVNAISVFTGLGGSAGNTATWLAHLGMKVGFIG
AVGNDDFGRLHLEFFKKIGVDTRGIKVVDEPTGIAVTMVRGEDKRIVKYPGANRFKEINM
DYLKLAKHLHLSSNPVELIRDAVNKAKSLGLTVSFDPGEMEVPQDIEEKIDILMMNEDEF
KAKYGSLKNIKNIRSKIAIATLNGGGALVKDEIRNVHEVRGLSAEAVDTTGGGDAFNAGF
IYGFLNGWDVVSSAKLGMLLAYLTVQKVGARTAVRPISDIRKIAKELNLSIPL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggacgtaatttgcatgggaaatctaaattacgatattgtttttttaatggaa
agatttccagggattcacgagaaagtaaacgccattagtgtgttcacgggacttggaggc
tctgctggtaatactgcaacatggctagctcaccttggaatgaaggttggatttatagga
gctgtcggtaatgatgactttggaagactccatttagagttcttcaaaaaaataggagtt
gatacaagggggattaaggtagttgatgaaccaactggaatagccgtgacaatggtcagg
ggagaggataagagaatagtgaaatatcctggggccaatagatttaaggagataaacatg
gattacctaaagctcgcaaaacacctacatctatcctcaaatccagttgaattgataagg
gatgcagtaaataaagcaaaatcccttggattaacggtctcctttgatccaggagagatg
gaggttccccaagacatagaggagaagattgatatcctaatgatgaatgaggatgagttt
aaggcaaaatatgggagcctaaagaacatcaaaaatataagatcaaagatcgcaatagca
acgttaaacggaggaggagcactggttaaggatgaaataagaaacgtccatgaagttaga
ggcctttcagcagaagctgtggacactacagggggaggagacgcttttaatgctggattt
atatacgggttcctaaatggatgggacgtcgttagctcggccaagcttggaatgttattg
gcctacctaacggttcaaaaggttggagccagaactgcagtgagaccaattagcgatata
aggaagattgccaaggaattaaatcttagcatacctctttaa

DBGET integrated database retrieval system