KEGG   Pyrococcus sp. NA2: PNA2_0459Help
Entry
PNA2_0459         CDS       T01487                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pyn  Pyrococcus sp. NA2
Brite
Enzymes [BR:pyn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PNA2_0459
Transfer RNA biogenesis [BR:pyn03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PNA2_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(384958..386751)
Genome map
AA seq 597 aa AA seqDB search
MKSISADTVWRMEEAVREIVNALLSGKIRNREELNKIKIEVARKYHLPRLPKNSDIWRAL
PKDVREKFRDLLKKKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPSVGSPQSYTGKEP
SALRASQYGYHPYIIMMARLKQLYDIGHPIDKVEVIIQGGTFPAVDLDYQEWFIKCAFKA
MNDFHYFKDIDNLEEKLVRLILKGDRSVLDEDPEFRKAWERTHRKPYYYLEDEQRKNEKA
KVRMVGLTIETRPDWAFEKQIDRMLSFGTTRVELGVQTIFNFIHERTKRGHGVEEIVKAT
QLLKDAGLKINYHIMPGLPGSNFERDLYTFKTIFEDPRFRPDMLKIYPTLVTRDAPLYAW
YKAGLYRPYTTEEAVKLIVEAYKFFPKWVRVMRIQRDIPAHLIVAGVKHSNLGQLVFNEL
VRRGIRPREIRFREVGHQMQKFGKVPEVEHIKLLREDYEASEGLEIFLSFEDVKNDILIG
FLRLRIPSEKAHRKEINCCPSAIVRELHVYGPLVPIGEKPKYEWQHRGYGRELLAEAERI
AREEFDAKKILVISGVGVREYYRKFGYRKDGPYVSKRLDRSYADYGKSDKFDAHLNT
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctatcagcgctgatacggtgtggagaatggaagaggctgttcgtgagattgtg
aatgccttactctcgggaaagataaggaatagggaagaattaaataagataaaaattgaa
gttgccaggaagtaccatttacctaggttaccaaagaattccgatatctggagggctcta
cctaaggacgtgagggagaagtttagagacctcctgaagaagaaaccaactaggactatc
agcggcgtagctgtagttgcaatgatgacaaagccgtttccctgtcctcatgggcgttgc
atttactgtcctggtgggccaagtgttggttcaccccagagctacactgggaaggagcca
tcggctttgagggcttcccagtacggctatcatccttacataatcatgatggccagactt
aagcagctctatgatataggacatccaatagataaggttgaagtaataatccaaggagga
acgtttccagctgttgacttagattatcaggagtggttcataaagtgtgcatttaaagct
atgaacgactttcactacttcaaggacatagacaacctcgaggaaaagctcgtgcgccta
atccttaagggtgatagatctgttcttgacgaagatcctgagtttagaaaggcctgggag
agaactcataggaaaccctactattatctggaggacgagcagaggaaaaacgagaaggca
aaggttagaatggttggattaacgattgaaacgagacctgattgggcctttgagaaacag
atcgatagaatgctctcattcggaactacaagggttgagctcggcgttcaaactatattc
aacttcattcatgagagaaccaagaggggacatggtgttgaggagatcgtgaaggcaact
caactcctaaaggacgccgggcttaagattaactatcacataatgccaggtctccctggg
agcaactttgagagagatctttacaccttcaagacgatatttgaggatccgaggtttaga
cctgacatgcttaagatatatccaactctagtaacgagggatgcccctctctatgcttgg
tataaagcgggtctatataggccttataccactgaagaagctgttaaattaattgttgaa
gcatacaaattcttcccgaagtgggtaagggtgatgaggattcaaagggatattccagct
catcttatagttgctggggttaagcactcaaatctagggcaattagtgttcaatgaactt
gtaaggaggggaataaggccaagggaaataaggtttagggaagtagggcatcagatgcag
aaatttggcaaggttcctgaggttgagcacataaagttgctcagggaggattatgaggca
tctgaaggactggagatattcctcagcttcgaggacgttaagaatgatattctaataggc
tttttaaggcttagaataccgagtgaaaaggcccacagaaaggagataaattgttgtccc
tctgcaatagtcagggaactccatgtttatggtcctctggttcccattggagagaagcca
aaatacgaatggcaacatcgcggttatggaagagagctcttagctgaggctgagagaatt
gctagagaggagtttgatgcgaagaagatactagtcattagtggtgttggggtgagagaa
tactataggaaatttggatataggaaagatggtccttatgtgagcaaaaggttggacagg
agctatgcagattatgggaagagtgacaagtttgatgctcatctaaatacttga

DBGET integrated database retrieval system