KEGG   Pyrococcus sp. NA2: PNA2_0471Help
Entry
PNA2_0471         CDS       T01487                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PNA2_0471
   01230 Biosynthesis of amino acids
    PNA2_0471
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PNA2_0471
   00051 Fructose and mannose metabolism
    PNA2_0471
   00562 Inositol phosphate metabolism
    PNA2_0471
Enzymes [BR:pyn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PNA2_0471
Exosome [BR:pyn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PNA2_0471
  Exosomal proteins of bladder cancer cells
   PNA2_0471
  Exosomal proteins of melanoma cells
   PNA2_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(397739..398428)
Genome map
AA seq 229 aa AA seqDB search
MAKLEEPIIAINFKTYIEATGKRALEIAKAAERVYKDTGVTIVVAPQLVDLRMIAESVEI
PVFAQHVDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIARAKEVGLMT
MVCSNNPMVSAAVAALNPDYVAVEPPELIGTGIPVSKAKPEVITGTVELVKKVNPDVKVL
CGAGISTGEDVRKALELGTVGVLLASGVTKAKDPEKAIRDLVSGIIGKS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacttgaggaaccaattatagcaataaatttcaaaacttacatcgaagcaact
ggaaagagagctttagagatagcaaaggctgcggagagggtttacaaagatacgggagtt
accatagtcgttgctcctcaactagttgaccttaggatgatagctgaatcggttgagatt
cctgtgtttgctcagcatgtagatccgataaaacctggaagccacactggacacgttctt
ccagaggctgtaaaagaggctggtgccgttggaactcttctcaaccattctgagaacaga
atgatactcgccgatcttgaggctgcaatagctagagctaaggaagttgggttaatgacg
atggtttgttcaaataacccgatggtttcagcagctgttgcagctttaaatcctgattat
gttgccgttgaacctccagagttaattggaactggaattccagttagcaaggcaaagcct
gaagtcataactgggactgtggaactagtcaagaaggttaatccggatgttaaggttctc
tgtggtgctggaatttccacgggagaagatgttaggaaggcattggaacttggcacggtt
ggcgttctcttggctagcggagttacaaaggcaaaggatccagagaaggcgataagagat
ttagtgtctggaataataggaaaaagttag

DBGET integrated database retrieval system