KEGG   Pyrococcus sp. NA2: PNA2_0473Help
Entry
PNA2_0473         CDS       T01487                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pyn  Pyrococcus sp. NA2
Brite
Enzymes [BR:pyn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PNA2_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(399082..399735)
Genome map
AA seq 217 aa AA seqDB search
MNDLYERWKRTVEMLELEGIIKSKEVKEAFLKYPRYLFVEERYKKYAHIDEPLPIPAGQT
VSAPHMVAIMLEIAKLKPGMNVLEVGTGSGWNAALISYLVKRDVYTIERIPELVEFAKRN
LERAGVKNVHVILGDGSKGFPPKAPYDVIIVTAGAPKIPDPLVEQLKPGGKLIIPVGSYH
LWQELLEVIKKKSGDIEIKSHGGVAFVPLIGEHGWKE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctttatgaaagatggaagagaaccgttgagatgctggaactcgaaggaata
attaaaagtaaagaggttaaggaggcctttctcaaatatcctaggtatcttttcgtggag
gagagatacaagaagtatgctcacattgacgagcctcttccaatacctgctggacaaacg
gttagtgctccccatatggtagcgataatgctggagatagctaagttaaagcctggaatg
aatgttcttgaggttggaactgggagtggatggaatgctgctcttatttcctacttagtg
aagagagatgtatacacaatagagaggatccccgaactcgttgagtttgcgaagaggaac
ctagagagagcaggtgtaaagaatgtacacgtaatccttggtgatggtagtaaggggttt
cctccaaaggctccctatgacgttataatagtcacagcgggtgcccctaaaattccggat
ccacttgtggaacaattaaagccagggggtaagcttataattcctgtgggaagctatcac
ctttggcaggagttgctggaggttataaagaagaaaagtggagacattgagatcaaaagt
catggaggagttgccttcgttccacttataggagagcatgggtggaaggaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system