KEGG   Pyrococcus sp. NA2: PNA2_0553Help
Entry
PNA2_0553         CDS       T01487                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PNA2_0553
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PNA2_0553
Enzymes [BR:pyn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PNA2_0553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(475722..477578)
Genome map
AA seq 618 aa AA seqDB search
MFGYKNRIARINLTNEKVRYERLEDEVIRKFIGGKGLGYYLIYKEVPPGTNPLSPANKMI
FAAGGLTGLIPGSSKVIAVSKSPETRLITDSSGGDAFGPKLRGHFDVLIIEGKAEEPVYI
YVHDGEAEIIDARDLWGKGVHEATRELWKKYPKASVAMIGPAGEKLSRIANIVYDTERAS
GRGGLGAVLGSKKVKAIVVEPGEKPEVANPEEYEILWKEFYERFSTDPKYEHSRNYGTTD
GLRSSASLGMSPAYNFSKPYIPDELASKLAGDEVKRYEVEPEWFIHGKSCPIKCARYIEV
EYKGRRIKVKPEYESLAMLGAATGVFNLKAVAYFNWLANDLGLDSIAAGNTIAWFFELVE
RELIDEEEIGFPVKGFGDEEAEEKLLIMMAERRGIGAILADGVRRACERLGRGCEFAVHV
KGLEAPAWDPRGRRTYALSYATADVGASHLRGWPRPHQLPNQGSAKELVPSLIESRDESY
ITDMLGVCKFVPYTIEDLARLYSVTTGENWSVEELRRRAWGVENIARIHNVLDWVTPPYD
DVIPPRWWEPEQDGPAKENKAFIDYNDFLEARREFYRLRGWHEELGVPLPETMEALGLPE
FKEDAKRAIEVVKMRTGL
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgttcggttataagaacagaatagcaagaataaacctcacgaatgagaaggttaggtac
gagagactggaagatgaggtcataaggaagttcataggaggaaagggtctcggatactac
ctcatctacaaggaggttcctccaggaactaatcctctaagccctgcaaataaaatgata
tttgctgccggtgggttaactggcctgatccctggttcaagcaaggtaattgcagtaagc
aagagtcctgaaacaaggttaatcacagattccagcggaggagatgcctttggtccaaag
cttagggggcactttgatgtcctaataatagaaggtaaagctgaggagccagtttacatc
tatgtacacgatggagaggccgagataatcgatgctagggatctctggggtaagggagtt
catgaggctaccagagaactttggaagaaatatccaaaggccagtgtggcaatgattggc
ccagcaggagaaaaattgagcaggatagctaacatagtctatgacaccgagagggctagt
ggaagaggggggcttggagctgttcttgggagtaagaaggttaaggctatcgtcgtagag
cctggagagaagccagaggttgcaaatccagaggagtatgagatactctggaaagagttc
tatgagaggttttcaacggatccaaagtatgagcacagtagaaactatggaaccacagat
gggttgagaagctcagcatcccttggaatgagtccggcatacaacttctccaaaccatac
attcccgatgaattggccagcaagttagcgggtgatgaggtgaagaggtatgaggttgag
cccgagtggttcattcatgggaagagctgtccaataaagtgtgcaaggtatatagaggtt
gagtataagggtaggaggataaaggtaaagccagaatacgaaagcctggcaatgcttgga
gcggcaactggagttttcaacctcaaggctgtggcttacttcaactggcttgccaatgat
cttggcttggatagcatagctgctggaaatacgatagcatggttctttgagctcgtcgag
agggaattaatagatgaagaggaaataggatttccagttaagggatttggagatgaagaa
gcagaggagaaattactgataatgatggcggagcgtaggggaataggtgctatccttgcg
gatggcgtcaggagggcctgtgaaagacttggaagaggctgtgaatttgcagttcatgtg
aagggcttagaagctccggcttgggatcctaggggaaggagaacttatgccttgagctat
gctacagccgacgttggtgcaagccatctgaggggatggccaagacctcatcagcttcca
aatcaggggtctgccaaggagctggttccctctttgatagagagtagagatgagagttac
attactgacatgctgggcgtctgtaagttcgtgccatatacaattgaggatttagcaaga
ctttactccgtgacaacaggtgagaactggagcgttgaagagcttaggagaagggcctgg
ggagttgaaaatatagcaaggattcataacgttcttgactgggtaactcctccctatgat
gatgtcattcctccaagatggtgggaacccgagcaggatggtccagctaaggaaaataaa
gcgtttatagattacaatgacttcctggaggcaaggagagaattctataggctaagaggg
tggcatgaagagcttggagttccattacctgagacgatggaagcattgggactacctgaa
tttaaggaagacgctaaaagggccattgaggtcgtgaagatgagaactgggctttag

DBGET integrated database retrieval system