KEGG   Pyrococcus sp. NA2: PNA2_0622Help
Entry
PNA2_0622         CDS       T01487                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PNA2_0622
Enzymes [BR:pyn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PNA2_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536498..537358
Genome map
AA seq 286 aa AA seqDB search
MLLHTYKSFDMELPTVSLEEADFIILGLPFDGTTSYKPGARFGPVIIRQATLNLESYVID
YDIDIAELKIGDAGDVALPVTIEDAIKVAEETIEELRRLNERALPIFLGGEHSMTYPAVK
VLKPKSYVVFDAHLDLRDSYQGSKFNHACVARRIHELGTKVIVFGVRSAAKEEVKYANKE
GIEWVHARDYNFDAFVDLVFELPEPVYVSIDIDVFDISLVPETGTPEPGGLRFWDIIEAL
EWITERKRIVGFDIMEVSGERLGNQAAITAAKLLFYILAMSAREGR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctcctccacacatacaaatcctttgacatggagcttccaacggttagcttagaggag
gccgacttcataatcctaggcctaccatttgatggaacaacaagctataagccaggggcg
agattcggacccgtgataattaggcaggccacgcttaacttggagagctacgtcatagat
tacgacatagacatagccgagctaaagattggggacgctggagatgttgcattaccggtg
acaattgaagatgcaatcaaggttgcagaagaaactatagaggagctaaggagattgaat
gaaagggccttacccatattccttggcggggaacattcaatgacgtatccagccgtaaag
gttctcaaaccaaagagttacgtagtctttgacgctcatttagatctaagggattcttat
caagggtcaaaattcaaccatgcctgtgttgctagaagaatccacgagctcggtactaag
gtgatcgtatttggtgttaggagcgcggcaaaggaagaagttaagtacgcaaataaggaa
ggaatagaatgggttcacgctagggattacaacttcgacgcctttgttgaccttgtcttt
gaacttccagagccagtgtacgtttccatagatatagatgtattcgacatatccctagtt
cctgagacggggacaccagagcccggaggattaagattctgggacatcatcgaggccctc
gagtggataacggagagaaagaggatagttggctttgatataatggaggtaagtggagag
agacttggaaatcaggcggcaataaccgcggctaagctattgttttacatattagcgatg
agtgcaagggaaggaagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system