KEGG   Pyrococcus sp. NA2: PNA2_0781Help
Entry
PNA2_0781         CDS       T01487                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PNA2_0781
  Amino acid metabolism
   00300 Lysine biosynthesis
    PNA2_0781
Enzymes [BR:pyn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PNA2_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
705424..706665
Genome map
AA seq 413 aa AA seqDB search
MEILEKVSKEIERLRDDMVKTLIELIQIPAISPDYGYEGEYDKAQKLLEIIRNWPFDKVE
VFNAPDERAKNGVRPSILAYYYGQDGDKSPRLWILTHLDVVPPGDLSKWTVTEPFKPVVR
DGKVYGRGSEDNGQGIVSSLYAVKALMNLGIRPKRTIILAFVSDEETGSKYGIEWLMNNH
PELFRKDDLVLVPDGGNSEGTFIEVAEKSILWFKVKVKGKQAHASMPNKGLNAHRIASEI
LVSIDRMLHEKYSKRDELYDPPESTFEPTMVGNSAGSPNILPGEHEFVFDCRVLPDYSLD
EVISDVRGICKSITEKYGAGFDIEVLQRLDAPQPTDPNSEIVRLLKEAIRILRGKEAKVG
GIGGGTFAAFFRKRGIPAVVWATLDETAHQPNEYAKIDNIVEDAKVMAALSLL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtggaaattctagaaaaagtttccaaggagatagaaaggttaagagacgacatggtgaaa
actctcattgagcttatacagatcccagcaataagcccagattacggctatgagggtgaa
tacgacaaggctcaaaagcttctggagataattaggaactggccatttgacaaggttgag
gtttttaatgctcctgatgagagggcaaagaacggtgtaaggccgagtatcttggcctac
tactacggccaggacggcgataaaagcccacgcctctggattttgactcatctagatgtc
gttccgccgggagatttgagcaagtggaccgtgactgaaccttttaaacctgtggttagg
gatgggaaggtttatggtaggggtagtgaggataatgggcaggggatagtgtcgtcgctg
tatgcggtgaaagcattgatgaatcttggaataaggccaaaaagaacaataatcctagca
ttcgtaagcgacgaagaaaccggaagtaaatatggaatcgagtggttgatgaacaaccat
ccggagctcttcagaaaagatgatcttgttctagttcctgatggtgggaattcggagggg
acttttatagaggttgctgagaagagcatcctctggttcaaagttaaggtgaaaggtaag
caggctcatgcaagcatgccgaataaaggattgaatgcccacagaatagcttccgaaatt
ctcgtttccattgataggatgttacatgagaagtactctaagagggatgaactgtacgat
cccccggagagcacattcgaacctacgatggtcggcaattcagctggttctccaaatata
ctccctggtgagcacgagtttgtatttgactgtagagtactcccagattatagcttagat
gaggtaatctccgacgtaagaggaatctgcaaatcaataactgaaaaatatggtgcagga
tttgacattgaagttctccagaggcttgatgcccctcagccaactgatccaaatagcgag
atcgttaggttgctaaaggaggctataagaattctaagaggaaaagaggctaaagttgga
ggaataggaggaggaacatttgcggcattcttcagaaaacgtggaattccggctgtagtt
tgggcaaccctggatgagactgcccatcagccaaatgaatatgctaagatagacaacatc
gttgaggacgcaaaggttatggcagcattgtcccttctttga

DBGET integrated database retrieval system