KEGG   Pyrococcus sp. NA2: PNA2_1055Help
Entry
PNA2_1055         CDS       T01487                                 

Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PNA2_1055
   00052 Galactose metabolism
    PNA2_1055
   00500 Starch and sucrose metabolism
    PNA2_1055
   00520 Amino sugar and nucleotide sugar metabolism
    PNA2_1055
Enzymes [BR:pyn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PNA2_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(966624..967502)
Genome map
AA seq 292 aa AA seqDB search
MKVRKAVIPAAGLGTRMLPITKSMPKEMLPIVDRPAIHYVVEEAIKAGIEDILIITGKGK
RAIEDYFDRSFELEYYLRERGKFEELKQVEEIGEMVDIYYVRQKKPLGLGDAILHAEKHV
NGEPFAVLLGDDIIISKKPAIKQLMEVAERKNTSVIGVEKVPWELVSRYGIINGRKIDEQ
LYTITDMVEKPSPDEAPSNMAIIGRYVLIPEIFDFLKETPPGKGGEIQLTDALRAMLNEY
EMLARVISGRRYDIGTRIGFIKANIELSLLRDDLREGVILLIKNILQEVQDE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttaggaaggcggtgattccagccgctggcttgggaacaagaatgcttccgata
accaagtcgatgccaaaggaaatgctaccaatagttgacaggccggccattcactatgtt
gttgaggaggccattaaagccggaatcgaggacatcttgattatcactggaaagggaaag
agagcgattgaggattattttgacaggagttttgagttagaatactaccttagagagagg
ggcaagttcgaggaactgaagcaggtggaagagattggagagatggtggacatttactac
gtgaggcagaaaaaacccctcggattgggagatgcaatactacacgcggaaaaacacgta
aacggagaacccttcgcagtcctactaggagacgacatcataatcagcaaaaaaccagca
atcaaacaactaatggaagttgcagagcgaaagaatacgtctgtaatcggtgttgagaaa
gtaccatgggagctagtcagcagatacgggataataaatggacgaaaaatcgatgaacag
ctttacacgataacagatatggtagagaaaccatccccagacgaagcaccaagcaacatg
gcaataataggaagatacgtactaattcctgaaatctttgatttccttaaagaaactccc
ccaggaaaaggaggggagattcagctcacggatgcattaagagcaatgttaaacgaatat
gagatgcttgcaagagtaatttcggggagaagatatgatatcggaacacgcattggcttt
atcaaagcgaacatcgaactcagtttacttcgagatgatctaagggaaggagttatctta
ttaataaaaaacattcttcaggaggttcaagatgagtag

DBGET integrated database retrieval system