KEGG   Pyrococcus sp. NA2: PNA2_1133Help
Entry
PNA2_1133         CDS       T01487                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PNA2_1133
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PNA2_1133
Enzymes [BR:pyn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PNA2_1133
Two-component system [BR:pyn02022]
 CheA family
  CheA-CheYBV
   PNA2_1133
Bacterial motility proteins [BR:pyn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PNA2_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1042159..1043265
Genome map
AA seq 368 aa AA seqDB search
MPLSGRKIRVLVVDDSAFMRKVLKDIINSDPELEVCGEARDGIEAIEMVQKCKPDVVTLD
VEMPRMNGLDALRVIMKRYPVPVIMISALTQEGAEATIKALEYGAIDFIPKPSSSISLNI
KEMKDEIIAKIKEAAKVPRRFLELRRIRLLRVQKAKKVKPSVPARIAVAIAASTGGPQSL
LKIFPKFPEDLKAGILLVQHMPPGFTRSFAKRLDSVSKIDVKEAEEGDVVEEGKAYVAPG
DYHMEVTLRGGKPVITLNKKPKIHGVRPAADPTMISAAQVFGRRTVGVVMTGMGRDGAQG
IVEIKKKGGITIAQDEKTSIIFGMPKAAIETGMVDYVVPLDKIPETVVRAVETIRGGGGL
GRHVTISR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgagtggaaggaaaatcagagtacttgttgttgatgactccgcatttatgagg
aaagtcctaaaggatataataaactcggatccagagctggaggtttgtggcgaggctagg
gatggcattgaagcaatagagatggttcagaagtgtaagccagacgtcgttaccttagac
gttgaaatgccaaggatgaatggattggatgcacttagggtgataatgaagaggtatcct
gtcccagtgataatgataagtgcgttgacccaggaaggagctgaagcaacgataaaggcc
cttgaatatggtgcaatagatttcatccctaagccttcctcctcaatatccttgaacatc
aaggagatgaaagatgaaattattgcgaagattaaagaggcggctaaggttcctcggagg
ttccttgaacttaggagaatcaggttacttagggttcaaaaggctaagaaggttaagccc
tccgttccggcgagaattgcggtggcaatagcagcttcaactggaggccctcaatccctg
ctgaagatatttccgaagtttcctgaggatctcaaagctgggatattgctcgttcagcac
atgcctccaggattcactaggtcgttcgcaaagaggcttgacagtgtttcaaagatcgac
gtaaaagaggccgaagagggggatgttgtcgaggaaggaaaagcatacgtggctccaggg
gattatcacatggaggtaacactgagaggcggaaagccggttatcacgctaaacaagaag
ccaaagattcatggagtaagacctgcggccgatccaacgatgataagtgcagctcaagta
tttggtagaagaaccgttggggttgtgatgactgggatgggcagagatggagcccaggga
atagttgaaatcaagaagaaagggggaataacaatagctcaagatgaaaaaacatctata
atctttggaatgccaaaggcagcgatagaaactggaatggtcgattacgtagtacctctc
gacaagatacctgagaccgttgtgagggccgtggagacgataaggggaggtggtgggctt
ggaagacatgtcacaatatctcgatga

DBGET integrated database retrieval system