KEGG   Pyrococcus sp. NA2: PNA2_1294Help
Entry
PNA2_1294         CDS       T01487                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit alpha
Orthology
K00186  
2-oxoisovalerate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.7]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pyn00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1190567..1191772
Genome map
AA seq 401 aa AA seqDB search
MEKVAGSVEYKPIKKVVSGNYAAAYAALHARVQVVAAYPITPQTSIIEKIAEFIANGEAD
IQYIPVESEHSAMAACIGASATGARVFTATSAQGLALMHEMLHWAAGARLPIVMVDVNRA
MAPPWSVWDDQTDSLAQRDTGWMQFYAENNQEVYDGVLMAFKVAETVNVPAMVVESAFIL
SHTYELVEMIPQELVDEFLPPRKPLYTLTDFDNPIAVGALATPADYYEFRYKLAKAHEEA
KKVIKDVGREFGERFGRDYSEMIEKGYIDDADFVFMGMGSLMGTVKEAVELLRKEGYKVG
YAKVRWFRPFPREEVVEIAESVKGIAVLDRNFSFGQEGILFTEAKGVLYNEGVRPIMKNY
IVGLGGRDFTVKDAKIIAEDMKKIIESGKLDREIEWYHLKR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagttgctggtagcgttgaatacaaacctattaaaaaggtcgttagcggtaat
tacgccgcagcatacgctgcacttcatgctagagttcaggtagttgccgcttatccgata
acgccacagacgagtataatcgagaagatagctgaattcatagccaatggcgaggctgac
atccagtatatacccgtagaaagtgaacattcggcaatggctgcttgtataggtgcaagt
gcaacgggggctagagttttcacggcaacctcggcccagggattagccctgatgcacgag
atgctccactgggcagccggagctaggctaccaattgtcatggttgatgtaaacagagca
atggcacccccctggagcgtctgggatgatcagacagatagcttagcacagagggatact
ggctggatgcaattttacgctgaaaacaaccaggaagtttacgatggagtgctaatggca
tttaaggtcgctgaaaccgttaacgttccagcgatggtagttgagagtgccttcatattg
agtcacacctacgagttagttgaaatgatcccccaggaattggttgatgaattcctacct
ccaaggaagcccctatatactttgacagactttgacaatccaatagccgttggagctctc
gcaactccagctgactactatgagttcaggtacaagcttgctaaagctcacgaagaggct
aagaaggtcataaaagacgttggtagggaattcggggagagatttggaagagattacagt
gagatgatagagaagggatacatagatgatgcagatttcgtcttcatgggcatgggctca
cttatgggtaccgtaaaggaggccgttgagttacttaggaaagaaggttacaaagttggc
tatgcaaaggtaaggtggttcagacccttcccgagggaagaagtagttgagatagctgag
agcgtcaagggaatagcggttcttgacagaaacttctcgttcggacaggagggaatatta
tttacagaggcaaagggagtactatacaatgagggagttagaccaataatgaagaactac
atagttggacttggtggaagggacttcacggtcaaggatgctaagataatagccgaggac
atgaagaagattattgaaagtggaaaattggatagggaaattgagtggtatcaccttaag
aggtga

DBGET integrated database retrieval system