KEGG   Pyrococcus sp. NA2: PNA2_1295Help
Entry
PNA2_1295         CDS       T01487                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit beta
Orthology
K00187  
2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pyn00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1191778..1192713
Genome map
AA seq 311 aa AA seqDB search
MEVPENIKRKLTIPFEENFFAGHTACQGCGASLGLRYVLKAYGKKTIIAIPACCSTIIAG
PWPYSALNANLFHTAFETTGAVISGIEAALKALGYKVKGEDGIMVVGWAGDGGTADIGLQ
ALSGFIERGHDAVYIMYDNEAYMNTGIQRSSSTPYGAWTTNTPGGKRHFLEKRHKKKVID
IVIAHRIPYAATASVAYPEDFMRKLKKAQKIPGPSFIQLFAPCPTGWRAPTDKTIEIARL
AVQTAYFPLFEYENGKYKINMPNPKKEPKPIEEFLKLQGRFKYMTKEDIDALQKWVLEEW
ERLKKLAEIFG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaagttcctgaaaacattaaaaggaagctcacaattccttttgaagaaaatttcttt
gcaggccatactgcatgtcagggttgtggggcctctcttggtttgagatatgttcttaag
gcttatggaaagaagacgataattgcgataccagcatgctgttcaactataattgcagga
ccgtggccatactcagccttgaacgctaacctattccatactgctttcgagacaactgga
gcagtaataagtggtatcgaggcagcattaaaggctctagggtataaggttaaaggggaa
gacggaataatggttgtaggttgggccggtgacggtggaactgcagacataggcctgcag
gcattgagtggtttcatagagaggggacatgatgcagtctatataatgtatgacaatgaa
gcctacatgaacactggaattcagaggtcaagttcaactccctacggagcatggacgaca
aacactccaggaggaaagaggcacttccttgagaagaggcataagaagaaggtcattgac
atagtcatagctcatagaattccatatgcagcaacggcaagtgtcgcttatccagaggat
ttcatgaggaagcttaagaaggctcaaaagatccctggaccaagcttcatccagctcttc
gctccctgcccaacgggatggagagctccaacagataaaaccattgaaatagctcgttta
gctgtccaaactgcatacttcccgctctttgagtatgaaaatggaaaatacaagataaac
atgccaaatccaaagaaagaacctaaacccattgaagaattcctaaagcttcagggcaga
tttaagtacatgacgaaggaagatattgatgccctccagaagtgggtattggaggaatgg
gaaaggttgaagaagttggctgagatatttggctga

DBGET integrated database retrieval system