KEGG   Pyrococcus sp. NA2: PNA2_1365Help
Entry
PNA2_1365         CDS       T01487                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pyn00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pyn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1251917..1252843
Genome map
AA seq 308 aa AA seqDB search
MDWKGRDVISIRDFSREDIEVVLSTAERLEREMKEKGQLEYARGKILATLFFEPSTRTRL
SFESAMHRLGGSVIGFAEASTSSVKKGESLRDTIKTVEQYADVIVIRHPKEGAARLAAEV
AEVPVINAGDGSNQHPTQTLLDLYTIKKEFGRIDGLKIGLLGDLKYGRTVHSLAEALSHY
DVELYLISPSLLRMPRHIVEELKEKGMKVIETTKLEEVIGELDVLYVTRIQKERFPDEQE
YLKVRGSYQVNLDTLRNVKETLRIMHPLPRVDEIHPEVDRTKYAIYFKQVFNGVPVRMAL
LGLVLGVI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggactggaaaggtagagatgttattagcattagggacttttctcgggaagacatagag
gttgtgctttcaacggccgagaggcttgaaagggaaatgaaagagaagggacagcttgag
tatgccagaggaaaaatattagctacactgttctttgaaccttcaacaaggactaggttg
agctttgagagtgccatgcatagactgggaggttcggtaattggattcgccgaggcctcg
actagtagcgttaagaagggtgaaagtctgagggatacaataaagacggttgagcagtat
gcagatgtcattgtgataaggcatccaaaggaaggtgcagctagactggcagctgaagtt
gctgaagttccagtaataaatgccggtgatggaagtaaccagcacccaactcaaacttta
cttgacctatacacaatcaagaaggaatttggaagaatagacgggctcaagataggtctt
ctgggtgatctaaagtatggaagaactgtccacagtcttgctgaagccctctctcactat
gatgttgagctctacttgatatctccaagccttctcaggatgccaagacacatagttgag
gagctaaaggagaagggaatgaaggtcattgaaacgacgaagcttgaggaggtaatagga
gaactcgacgtgctctacgtgacaagaatacagaaggagagatttccagatgagcaagag
tatcttaaggttagaggtagctaccaggtgaaccttgatacgctgagaaacgtcaaggaa
actctaaggataatgcatcctctaccgagggttgacgaaatacatcccgaggtcgataga
acgaagtatgcgatatacttcaagcaggtgtttaatggtgttccagttagaatggccctc
ttgggtctcgttctgggggtgatttga

DBGET integrated database retrieval system