KEGG   Pyrococcus sp. NA2: PNA2_1520Help
Entry
PNA2_1520         CDS       T01487                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PNA2_1520
Enzymes [BR:pyn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PNA2_1520
    3.5.1.-  
     PNA2_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1398144..1398686
Genome map
AA seq 180 aa AA seqDB search
MPEEALIVVDMQRDFMPGGALPVPEGDKIIPKVNEYIRKFKEKGALIVATRDWHPENHIS
FKERGGPWPKHCVQNTPGAEFVVDLPEDAIIISKATEPDKEAYSGFEGTNLAEILKDNGV
KRVYICGVATEYCVRATALDALRHGFEVYLLVDAVKGIRPEDEKKAIEEMKEKGIKIMTL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagaggcgttgatagttgttgacatgcagagggatttcatgccaggaggagct
cttcccgttccagaaggggataagataataccgaaggtaaatgaatatataaggaagttt
aaagaaaaaggtgccttgatagttgcaacaagggactggcacccagagaatcatataagc
tttaaggagagaggaggaccttggccaaagcattgtgttcaaaacactccaggagcggaa
tttgttgttgacctaccagaggatgcaataataatttccaaggccacagaacctgataaa
gaggcttattctggttttgagggcacgaatcttgctgagatccttaaagataatggagtg
aagagggtttacatctgtggagtggccactgaatattgtgttagggctacggcacttgat
gcactcaggcatggattcgaagtttacttacttgtagatgccgtgaagggaataaggcct
gaagacgaaaagaaagcaatagaggagatgaaagagaagggaatcaagattatgactctt
tag

DBGET integrated database retrieval system