KEGG   Pyrococcus sp. NA2: PNA2_1620Help
Entry
PNA2_1620         CDS       T01487                                 

Definition
ribulose bisophosphate carboxylase
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PNA2_1620
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PNA2_1620
Enzymes [BR:pyn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PNA2_1620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1514359..1515615
Genome map
AA seq 418 aa AA seqDB search
MEWYLDFVDLDYTPGRDELIVEYYFEPNGVSPEEAAGRIASESSIGTWTTLWKLPEMAKR
SIAKVFYLEKHGEGYIAKIAYPLTLFEEGSLVQLFSAIAGNVFGMKALKNLRLLDFHPPY
EYLRHFKGPQFGVHGIREFMGVKDRPLTATVPKPKMGWSVEEYAEIAYELWSGGIDLLKD
DENFTSFPFNRFEERVRKLYRVRDKVEEETGETKEYLINITGPVHVMEKRAELVACEGGR
YVMIDIVVVGWSALQYMREITEDLGLAIHAHRAMHAAFTRNPRHGITMLALAKAARMIGV
DQIHTGTAVGKMAGDYEEIKRINDFLLSKWEHIRPVFPVASGGLHPGLMPELIRLFGKDL
VIQAGGGVMGHPDGPRAGAKALRDAIEAAVEGVDLEEKAKSSPELKKALEKWGYLKPK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggagtggtatctggacttcgttgacttggattacactccaggtagagatgagctcata
gttgagtactacttcgaaccgaacggagtttctccagaggaagccgctggaaggatagcg
agtgaaagctccataggaacctggaccacgctatggaagttgcccgaaatggctaagaga
agcatagccaaggtcttttacttagaaaagcatggagaaggttatatagctaagatagct
tatccattaacgctgtttgaggagggaagcctggttcagctgtttagcgcaatagccgga
aacgtctttggaatgaaggcattaaagaacctaaggttacttgacttccatccaccatat
gagtatctaaggcacttcaaaggacctcagttcggcgttcacggaatcagagagttcatg
ggagttaaggacaggccattgacggctacagtcccaaagccgaagatggggtggagcgtt
gaagaatacgctgagatagcctacgagctatggagtggtgggatagacctcctaaaggac
gatgagaacttcacgagctttccattcaacaggttcgaggagagagtgaggaagctttac
agggttagggacaaggttgaagaggagaccggagagactaaggagtacctgataaacata
acgggtccagttcacgtcatggagaagagagctgagcttgtcgcgtgtgaaggtggaagg
tacgtcatgatagacatagtggttgtcggttggagcgctctacaatacatgagggagata
actgaagatcttggattggccatacatgcccacagggcaatgcatgccgcgttcacgagg
aatccaaggcacggaataaccatgcttgcattggctaaagcggctagaatgattggggtt
gatcaaattcacactggaacggcagttggtaagatggctggagactatgaggagataaag
aggataaacgacttcctgctgagtaagtgggaacacataagacctgtatttccagttgca
agcggtggattacacccagggttaatgccagaattgataagactcttcggaaaggatcta
gtcattcaggcaggaggaggtgtcatgggccatccagatgggccaagagctggagcgaaa
gcacttagggatgcaattgaagctgctgttgaaggagttgatctcgaggagaaggccaag
tcaagtccagagcttaagaaggccttggagaagtggggatatttgaagccaaaataa

DBGET integrated database retrieval system