KEGG   Pyrococcus sp. NA2: PNA2_1620Help
Entry
PNA2_1620         CDS       T01487                                 

Definition
ribulose bisophosphate carboxylase
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pyn01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pyn00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1514359..1515615
Genome map
AA seq 418 aa AA seqDB search
MEWYLDFVDLDYTPGRDELIVEYYFEPNGVSPEEAAGRIASESSIGTWTTLWKLPEMAKR
SIAKVFYLEKHGEGYIAKIAYPLTLFEEGSLVQLFSAIAGNVFGMKALKNLRLLDFHPPY
EYLRHFKGPQFGVHGIREFMGVKDRPLTATVPKPKMGWSVEEYAEIAYELWSGGIDLLKD
DENFTSFPFNRFEERVRKLYRVRDKVEEETGETKEYLINITGPVHVMEKRAELVACEGGR
YVMIDIVVVGWSALQYMREITEDLGLAIHAHRAMHAAFTRNPRHGITMLALAKAARMIGV
DQIHTGTAVGKMAGDYEEIKRINDFLLSKWEHIRPVFPVASGGLHPGLMPELIRLFGKDL
VIQAGGGVMGHPDGPRAGAKALRDAIEAAVEGVDLEEKAKSSPELKKALEKWGYLKPK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggagtggtatctggacttcgttgacttggattacactccaggtagagatgagctcata
gttgagtactacttcgaaccgaacggagtttctccagaggaagccgctggaaggatagcg
agtgaaagctccataggaacctggaccacgctatggaagttgcccgaaatggctaagaga
agcatagccaaggtcttttacttagaaaagcatggagaaggttatatagctaagatagct
tatccattaacgctgtttgaggagggaagcctggttcagctgtttagcgcaatagccgga
aacgtctttggaatgaaggcattaaagaacctaaggttacttgacttccatccaccatat
gagtatctaaggcacttcaaaggacctcagttcggcgttcacggaatcagagagttcatg
ggagttaaggacaggccattgacggctacagtcccaaagccgaagatggggtggagcgtt
gaagaatacgctgagatagcctacgagctatggagtggtgggatagacctcctaaaggac
gatgagaacttcacgagctttccattcaacaggttcgaggagagagtgaggaagctttac
agggttagggacaaggttgaagaggagaccggagagactaaggagtacctgataaacata
acgggtccagttcacgtcatggagaagagagctgagcttgtcgcgtgtgaaggtggaagg
tacgtcatgatagacatagtggttgtcggttggagcgctctacaatacatgagggagata
actgaagatcttggattggccatacatgcccacagggcaatgcatgccgcgttcacgagg
aatccaaggcacggaataaccatgcttgcattggctaaagcggctagaatgattggggtt
gatcaaattcacactggaacggcagttggtaagatggctggagactatgaggagataaag
aggataaacgacttcctgctgagtaagtgggaacacataagacctgtatttccagttgca
agcggtggattacacccagggttaatgccagaattgataagactcttcggaaaggatcta
gtcattcaggcaggaggaggtgtcatgggccatccagatgggccaagagctggagcgaaa
gcacttagggatgcaattgaagctgctgttgaaggagttgatctcgaggagaaggccaag
tcaagtccagagcttaagaaggccttggagaagtggggatatttgaagccaaaataa

DBGET integrated database retrieval system