KEGG   Pyrococcus sp. NA2: PNA2_1708Help
Entry
PNA2_1708         CDS       T01487                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pyn  Pyrococcus sp. NA2
Pathway
pyn00260  Glycine, serine and threonine metabolism
pyn00750  Vitamin B6 metabolism
pyn01100  Metabolic pathways
pyn01110  Biosynthesis of secondary metabolites
pyn01120  Microbial metabolism in diverse environments
pyn01230  Biosynthesis of amino acids
Module
pyn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PNA2_1708
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PNA2_1708
Enzymes [BR:pyn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PNA2_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEC52623
UniProt: F4HKL3
Position
complement(1590309..1591493)
Genome map
AA seq 394 aa AA seqDB search
MVLRCIRCGREYPEDEIRYRCECGGLLEVVIDLDKVDTKIFDGNNITLWKYESWLPVKKR
VSLNEGGTPLYRLNNLEKILGVKELYAKNEGANPTGSFKDRGMTVGVSKALELGMKRVVC
ASTGNTSASLAAYAAKAGIGAYVLVPSGKIALGKLAQAIIYGAKVIPIKGNFDDALRVVI
EASRELGIYMLNSINPFRLEGQKTIAYEIYDQLQKVPDNIVLPVGNAGNISAIWKGFKEL
HEAGVIDKLPRMIGIQAKGASPLAKAWKERREFRPEKNPETVATAIRIGNPANWEKAWRA
VEESGGMFEVVSDEEILKAQRMLASKEGLFVEPASAASLAGLIKLLSEGKVNKDESFVLI
TTGHGLKDPDVVLRNFKLPEPIEPTLEAFRRVME
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtattgagatgcataagatgtggaagggaatatccagaggatgaaataaggtacagg
tgtgaatgtggaggattgctggaggttgtcatagaccttgataaggtagatacaaagata
tttgatggaaataacattacgttgtggaaatacgagagctggctacctgtaaagaagagg
gtttctctgaacgagggaggaactcccctatacaggttaaataatctggaaaagatcctt
ggggtgaaggagctatacgccaagaatgagggtgcaaatcctactggttcattcaaggat
agaggaatgactgttggagtttcaaaggcacttgagcttgggatgaagagagttgtttgt
gcatcaactggaaacacctcggcatctttggcagcgtatgcggctaaggcagggatagga
gcatacgtccttgtgccaagcgggaagatagctctagggaaacttgcccaagctataata
tatggagcgaaggtaattccaataaaggggaacttcgacgatgcacttcgcgtggtaatt
gaagcaagcagggaacttgggatatacatgctgaattcaataaatccattcagactagag
ggacagaaaacaatagcctacgaaatctatgatcaactacagaaggttcccgacaatata
gtcctgccagttggaaatgccggaaacatatcggcaatatggaagggattcaaggaactg
catgaggctggagttatagataagttgcccagaatgataggcatacaggctaagggggca
tcacctctagctaaagcttggaaagagagaagagaatttaggcccgaaaagaacccagaa
accgttgcaacggcaataaggattggaaatcctgcaaactgggagaaggcatggagggca
gttgaagaatcaggcggcatgtttgaggttgttagtgatgaggagatattaaaggctcag
agaatgcttgcttcaaaggagggtctcttcgttgaacctgcctctgcagcttcccttgct
gggctaattaagctgttaagtgagggcaaggtcaacaaggatgaaagcttcgttttgata
acaacaggtcatgggcttaaggatcctgatgttgttcttaggaatttcaagttgcccgaa
cctatagaaccgacactagaggcatttaggagggtgatggaatga

DBGET integrated database retrieval system