KEGG   Pyrococcus sp. NA2: PNA2_1805Help
Entry
PNA2_1805         CDS       T01487                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pyn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1678264..1679691
Genome map
AA seq 475 aa AA seqDB search
MCLIAGGFNIPREYAIKMIELGRHRGPDSFGFWSERQVIKSEDFSDVENIEGGKTALIQC
RLAMTGSKDYTQPFYNEIVLVHNGEIYNHEILREYLIERGASFETDVDSEVILRLLEYLI
FEKKMKVGEAVKLAMKMLRGDYAVAFFFNDRFYLFRDPLGVRPLYYSPNGHFASEKKVLW
GLEEDANPVLPGELVEISKHRIVKEKIFNILSIKVPGRSYVNGLMNILPDAVRIRANKKV
GVLFSGGLDSSLIAKIASEYSKVVLYTSGTEDSKDIEWARKVADELGLKLRESVFSKEDV
EAELERIMFAIEEPNPMNLAIAIPLYFSTKKAKEDGVKILLSGQGADELFGGYAKYMENP
GLMLKDIEELGEKNLARDDKVSMLNGVEVRYPYLDLPLAILALNVPLELKINGNRRKVIL
REVAKKMGLPEWIAEREKKAAQYGSNAQKILRKIAKSRGLKLREFADVLFSNVFH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctaatcgcaggaggattcaacatcccaagagaatatgccatcaagatgatagag
ttaggtaggcatagagggcccgattcttttgggttttggagcgaaaggcaggtaatcaaa
tcggaagacttctcggatgtggaaaatatagaaggggggaagacagctttaatccaatgc
agacttgccatgaccggttcaaaagattacacgcagccattctacaacgagatagttctc
gtccacaatggagagatatataaccatgagatcctcagggaatacctcattgaaaggggg
gcatcgttcgagaccgacgttgatagtgaggttatactgaggctgttggagtacctaatt
ttcgagaaaaagatgaaagttggtgaggcggttaaacttgcaatgaagatgctgagggga
gattatgctgttgcgttcttctttaacgataggttctatctctttagggatcctcttgga
gttagaccgctatactattctcccaacggccacttcgcttcagagaaaaaggtgctttgg
gggttagaggaagacgctaatcccgtcttgccaggagaattagtggagatctccaagcat
aggatagttaaggagaagatattcaacatcctctcaataaaagtcccaggaagaagttat
gtaaatggactaatgaacattctacctgatgctgtaaggatcagggcaaataaaaaagtc
ggagttctgttctcaggaggattggatagctcattgatagcgaagatagcatctgaatac
tcaaaagtcgttctttacacttccggaactgaggacagtaaagatattgagtgggccagg
aaagttgccgatgaactaggccttaaacttagggagagcgtgttctccaaggaggatgtg
gaggcagagttagagaggataatgtttgcaatagaggagccaaatcccatgaatcttgca
atagcgatacccctttacttctctacaaagaaggccaaggaagatggagttaaaattctt
ctaagtggacaaggtgcagatgaactcttcggaggttacgccaaatacatggaaaatcca
gggttaatgctcaaggacatcgaggagttgggagagaaaaaccttgcaagagatgacaag
gtgtcgatgttgaatggagttgaagttaggtacccttacttagaccttccgttggcgatc
ctcgcattgaacgtccccctagaacttaaaattaatggtaacaggaggaaagtgattctg
agggaggttgcaaagaaaatgggacttccggagtggatagcggagagggaaaagaaagca
gctcaatatggaagcaatgctcaaaagatcttaaggaagatagccaaatcgaggggtctt
aaacttagagaatttgccgatgtcctattctctaacgtgttccattga

DBGET integrated database retrieval system