KEGG   Pyrococcus sp. NA2: PNA2_1805Help
Entry
PNA2_1805         CDS       T01487                                 

Definition
(GenBank) asparagine synthetase, putative
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pyn  Pyrococcus sp. NA2
Pathway
pyn00250  Alanine, aspartate and glutamate metabolism
pyn01100  Metabolic pathways
pyn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PNA2_1805
Enzymes [BR:pyn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PNA2_1805
Peptidases [BR:pyn01002]
 Cysteine Peptidases
  Family C44
   PNA2_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: AEC52720
UniProt: F4HL39
Position
1678264..1679691
Genome map
AA seq 475 aa AA seqDB search
MCLIAGGFNIPREYAIKMIELGRHRGPDSFGFWSERQVIKSEDFSDVENIEGGKTALIQC
RLAMTGSKDYTQPFYNEIVLVHNGEIYNHEILREYLIERGASFETDVDSEVILRLLEYLI
FEKKMKVGEAVKLAMKMLRGDYAVAFFFNDRFYLFRDPLGVRPLYYSPNGHFASEKKVLW
GLEEDANPVLPGELVEISKHRIVKEKIFNILSIKVPGRSYVNGLMNILPDAVRIRANKKV
GVLFSGGLDSSLIAKIASEYSKVVLYTSGTEDSKDIEWARKVADELGLKLRESVFSKEDV
EAELERIMFAIEEPNPMNLAIAIPLYFSTKKAKEDGVKILLSGQGADELFGGYAKYMENP
GLMLKDIEELGEKNLARDDKVSMLNGVEVRYPYLDLPLAILALNVPLELKINGNRRKVIL
REVAKKMGLPEWIAEREKKAAQYGSNAQKILRKIAKSRGLKLREFADVLFSNVFH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctaatcgcaggaggattcaacatcccaagagaatatgccatcaagatgatagag
ttaggtaggcatagagggcccgattcttttgggttttggagcgaaaggcaggtaatcaaa
tcggaagacttctcggatgtggaaaatatagaaggggggaagacagctttaatccaatgc
agacttgccatgaccggttcaaaagattacacgcagccattctacaacgagatagttctc
gtccacaatggagagatatataaccatgagatcctcagggaatacctcattgaaaggggg
gcatcgttcgagaccgacgttgatagtgaggttatactgaggctgttggagtacctaatt
ttcgagaaaaagatgaaagttggtgaggcggttaaacttgcaatgaagatgctgagggga
gattatgctgttgcgttcttctttaacgataggttctatctctttagggatcctcttgga
gttagaccgctatactattctcccaacggccacttcgcttcagagaaaaaggtgctttgg
gggttagaggaagacgctaatcccgtcttgccaggagaattagtggagatctccaagcat
aggatagttaaggagaagatattcaacatcctctcaataaaagtcccaggaagaagttat
gtaaatggactaatgaacattctacctgatgctgtaaggatcagggcaaataaaaaagtc
ggagttctgttctcaggaggattggatagctcattgatagcgaagatagcatctgaatac
tcaaaagtcgttctttacacttccggaactgaggacagtaaagatattgagtgggccagg
aaagttgccgatgaactaggccttaaacttagggagagcgtgttctccaaggaggatgtg
gaggcagagttagagaggataatgtttgcaatagaggagccaaatcccatgaatcttgca
atagcgatacccctttacttctctacaaagaaggccaaggaagatggagttaaaattctt
ctaagtggacaaggtgcagatgaactcttcggaggttacgccaaatacatggaaaatcca
gggttaatgctcaaggacatcgaggagttgggagagaaaaaccttgcaagagatgacaag
gtgtcgatgttgaatggagttgaagttaggtacccttacttagaccttccgttggcgatc
ctcgcattgaacgtccccctagaacttaaaattaatggtaacaggaggaaagtgattctg
agggaggttgcaaagaaaatgggacttccggagtggatagcggagagggaaaagaaagca
gctcaatatggaagcaatgctcaaaagatcttaaggaagatagccaaatcgaggggtctt
aaacttagagaatttgccgatgtcctattctctaacgtgttccattga

DBGET integrated database retrieval system