KEGG   Pyrococcus sp. NA2: PNA2_1850Help
Entry
PNA2_1850         CDS       T01487                                 

Definition
formaldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pyn01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pyn00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1728749..1730614
Genome map
AA seq 621 aa AA seqDB search
MKGWWGRILRINLTTGEVKVQEYPEEIAKKFIGGRGLAAWILWNEVKGVDPLSPENKLVF
AAGPFNGLPTPSGGKLVIAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVVEGKAKRPVY
IYIEDDNVSILSAEGLWGKGTFETERELKEIHGKNVGVLSIGPAGENLVKFAVVMSQEGR
AAGRPGMGAVMGSKNLKAIVIRGTKEIPVANKEELKKLSQEAYNEILNSPGYPFWKRQGT
MAAVEWTNENSALPTRNFSDGSFEFARPIDGYTMEGMKIKQRGCPYCNMPCGNVVLDAEG
QESELDYENVALLGANLGIGKLNEVAVLNRIADDMGMDTISLGGVIGFIMEAKEKGLIKD
DEAPEFGDFKKAKELALNIAYRRTELGNFAAEGVKRMAEKLGDDSFAMHVKGLEVSGYNC
YIYPGMALAYGTSSIGAHHKEAWVIAWEIGTAPIEGEQAKKVEYKITYDPEKAAKVVELQ
RLRGGLFEMLTACRLPWVEIGLSLEYYPKLLKAITGVTYTWDDLYKAADRVYALIRAYWV
REFNGKWDRTMDYPPKRWFTEGLKSGPYKGQHLDREKYDALLSEYYRIRGWDERGIPTKE
TLKNLDLDFVIPELEKVVKLS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaagggatggtgggggaggattctaaggataaacttaacaactggagaagttaaagtt
caggaataccccgaagaaattgctaagaagtttattggtggtaggggactagcagcctgg
attctttggaatgaagttaaaggtgttgatcctcttagtccagaaaataagctcgttttt
gctgcaggtccttttaatggactaccaaccccaagcggtggaaagcttgttatcgcagct
aagagtccactaactggaggttatggtgacggaaatcttggaacaatggcctccgttcac
ttaaggagagcaggatacgatgcccttgtagttgaaggaaaggcaaaaaggcctgtatac
atctacatagaggatgataacgttagcattcttagtgccgaaggtctatggggtaaggga
acgttcgagacagagagagaacttaaggaaattcacggaaagaacgttggagtactcagc
atagggccagcgggagagaaccttgtaaagtttgcagttgtgatgtcacaggagggtaga
gcagcaggaagaccaggaatgggtgccgttatgggaagtaagaatcttaaggcaatagta
atcaggggaaccaaggagattccagttgcaaataaggaagagttaaagaagctcagtcag
gaggcgtataatgagatattgaactcgccaggatatccgttctggaagagacagggtaca
atggcagcagttgagtggacgaacgagaactctgcattaccaaccagaaactttagtgat
ggaagctttgagttcgcaaggccgatagacggttacacaatggagggtatgaagataaag
cagaggggatgtccatactgtaacatgccctgtggaaacgttgttcttgacgctgaaggc
caagagagcgagcttgattatgagaacgttgctttgctaggtgctaatcttggaatagga
aagctcaacgaggttgccgttctaaacagaatcgcggatgatatgggaatggataccata
agcctcggtggagttataggattcataatggaggccaaagagaagggacttatcaaggat
gatgaagctccagagtttggggactttaagaaggccaaggagttggcattgaacatagcc
tacagaagaacagagctagggaactttgccgctgaaggagtaaagaggatggccgagaag
cttggtgatgatagctttgcgatgcatgttaagggactcgaagttagcggttacaactgt
tacatctatccagggatggccctagcttatggaacaagctcaattggtgcccatcataag
gaagcctgggttatagcttgggagattggaactgcgccaatagagggtgagcaggccaag
aaggttgagtacaagataacctatgatccagaaaaggcggcaaaggtagttgagcttcag
aggctaagaggtggactcttcgagatgctgaccgcatgtagactaccatgggtcgagata
ggactaagcctagagtactatccaaagttgctcaaggccataacaggggtaacttataca
tgggatgatctttacaaggccgctgacagggtttatgcattgataagggcctactgggta
agagagttcaacggtaagtgggacaggacaatggattatccaccaaagagatggtttact
gagggattgaagagcggaccatacaagggacagcaccttgacagggagaaatacgatgca
cttctctccgagtattataggataaggggatgggatgagagaggaataccaaccaaagag
acacttaagaatctagacttagactttgtaattcctgaacttgagaaggtagttaagctc
tcctga

DBGET integrated database retrieval system