KEGG   Pyrococcus sp. NA2: PNA2_1982Help
Entry
PNA2_1982         CDS       T01487                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pyn01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pyn00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pyn00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1858301..1859620
Genome map
AA seq 439 aa AA seqDB search
MKCSRCGREYTSMIPPFCICGEELEIRYDYSKVDVNKWKNRSPGVWRYRELLPSVKRIIS
LREGGTPLIKARISEKLGIDVFIKDETRNPTGSFRDRLATVAISFGLPYATNGFIVASDG
NAAASVAAYSARAEKECFVVVPRKVDRGKLIQMIAFGARIIKYGDSVDDAIEYSRELAKL
NGLYNVTPEENIIGLEGQKTIAFELWEELNPSHIIIPTGSGSYLYSIYKGFRELIEIGVL
SEMPRLIAVQTEKCNPIAAEILGTKRECKETKALGLYVKDPVMKSRVVRAIKESNGTAIL
VSENEIDIGEKMLANEGIFAELSSAVVMPALIKLKEAGIIEKGDKVVLVVTGSGLKSGEG
GREKFSIGGTKLEILKILKERERYAYEIWQALGKPIKYQAIHQHIKELQELGLIEEAYRK
GKRIYYRLTEKGIRLVENL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgctcaaggtgtggtagggagtacacatcaatgataccccctttctgcatatgt
ggggaagaactcgagataaggtatgattactcgaaagtggatgtaaacaagtggaagaat
agaagtccaggagtgtggagatatagagaactcttaccaagtgtaaaaaggataataagc
ttgagagaaggaggtacacctctcataaaggccagaataagtgagaaactggggatagat
gttttcataaaagatgaaactaggaacccaactggctcatttagggacagacttgccacc
gttgcaatatcttttggattaccctatgcaacaaatggtttcatagttgcgagtgatgga
aatgctgccgcttccgtagccgcttattcagctagagctgagaaggaatgtttcgtcgtt
gttccgaggaaggttgacaggggaaaacttattcaaatgatagcttttggtgctagaatt
ataaagtatggagacagcgttgacgatgcaatagagtattccagagagttggcaaagctg
aacggactctataatgttacgccagaggagaatataatagggctggaaggtcaaaagacc
atagcctttgaactctgggaggagttaaatccgagtcatataattattccaacaggcagt
ggaagctatctgtattccatatataaaggattcagggaacttattgagatcggtgttcta
agtgaaatgccaaggttaatagcagtccaaaccgagaagtgcaaccctatagcagcagag
attttaggaacaaagagggagtgcaaggaaacgaaagccctcggcctctacgtgaaagac
cccgttatgaagtcaagggtagttagagcgataaaagagagtaatggaacggcaatttta
gttagcgaaaatgaaatagatattggagaaaagatgcttgcaaatgagggaatatttgca
gaactctcctcggcagttgtcatgccagcgttaataaagcttaaggaggcgggaataata
gagaagggggataaggtcgttcttgttgtcacaggttctggcctgaagagtggtgaggga
ggaagggagaagttttccataggtggaacaaagctcgaaattttaaagatcctcaaggaa
agagagaggtatgcctatgaaatatggcaggccctaggaaagcccattaagtaccaggca
attcatcaacacataaaagagcttcaggagctaggtttaatagaggaggcctataggaag
ggtaaaaggatatattacaggctcacggagaaaggtattaggctagtagaaaatttataa

DBGET integrated database retrieval system