KEGG   Pyrococcus sp. NA2: PNA2_1982Help
Entry
PNA2_1982         CDS       T01487                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pyn  Pyrococcus sp. NA2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pyn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PNA2_1982
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PNA2_1982
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PNA2_1982
Enzymes [BR:pyn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PNA2_1982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1858301..1859620
Genome map
AA seq 439 aa AA seqDB search
MKCSRCGREYTSMIPPFCICGEELEIRYDYSKVDVNKWKNRSPGVWRYRELLPSVKRIIS
LREGGTPLIKARISEKLGIDVFIKDETRNPTGSFRDRLATVAISFGLPYATNGFIVASDG
NAAASVAAYSARAEKECFVVVPRKVDRGKLIQMIAFGARIIKYGDSVDDAIEYSRELAKL
NGLYNVTPEENIIGLEGQKTIAFELWEELNPSHIIIPTGSGSYLYSIYKGFRELIEIGVL
SEMPRLIAVQTEKCNPIAAEILGTKRECKETKALGLYVKDPVMKSRVVRAIKESNGTAIL
VSENEIDIGEKMLANEGIFAELSSAVVMPALIKLKEAGIIEKGDKVVLVVTGSGLKSGEG
GREKFSIGGTKLEILKILKERERYAYEIWQALGKPIKYQAIHQHIKELQELGLIEEAYRK
GKRIYYRLTEKGIRLVENL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgctcaaggtgtggtagggagtacacatcaatgataccccctttctgcatatgt
ggggaagaactcgagataaggtatgattactcgaaagtggatgtaaacaagtggaagaat
agaagtccaggagtgtggagatatagagaactcttaccaagtgtaaaaaggataataagc
ttgagagaaggaggtacacctctcataaaggccagaataagtgagaaactggggatagat
gttttcataaaagatgaaactaggaacccaactggctcatttagggacagacttgccacc
gttgcaatatcttttggattaccctatgcaacaaatggtttcatagttgcgagtgatgga
aatgctgccgcttccgtagccgcttattcagctagagctgagaaggaatgtttcgtcgtt
gttccgaggaaggttgacaggggaaaacttattcaaatgatagcttttggtgctagaatt
ataaagtatggagacagcgttgacgatgcaatagagtattccagagagttggcaaagctg
aacggactctataatgttacgccagaggagaatataatagggctggaaggtcaaaagacc
atagcctttgaactctgggaggagttaaatccgagtcatataattattccaacaggcagt
ggaagctatctgtattccatatataaaggattcagggaacttattgagatcggtgttcta
agtgaaatgccaaggttaatagcagtccaaaccgagaagtgcaaccctatagcagcagag
attttaggaacaaagagggagtgcaaggaaacgaaagccctcggcctctacgtgaaagac
cccgttatgaagtcaagggtagttagagcgataaaagagagtaatggaacggcaatttta
gttagcgaaaatgaaatagatattggagaaaagatgcttgcaaatgagggaatatttgca
gaactctcctcggcagttgtcatgccagcgttaataaagcttaaggaggcgggaataata
gagaagggggataaggtcgttcttgttgtcacaggttctggcctgaagagtggtgaggga
ggaagggagaagttttccataggtggaacaaagctcgaaattttaaagatcctcaaggaa
agagagaggtatgcctatgaaatatggcaggccctaggaaagcccattaagtaccaggca
attcatcaacacataaaagagcttcaggagctaggtttaatagaggaggcctataggaag
ggtaaaaggatatattacaggctcacggagaaaggtattaggctagtagaaaatttataa

DBGET integrated database retrieval system