KEGG   Plasmodium yoelii: PY00116Help
Entry
PY00116           CDS       T01035                                 

Definition
choline kinase GmCK2p-like protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pyo  Plasmodium yoelii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PY00116
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PY00116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 441 aa AA seqDB search
MEDNNNRSNNIENGQIDLLNCNNNNNEDIKLLKIEKILSYDDLEAFNSIQLNQETEILAT
PFRSQEINLKNDIPLCAQEFSDLTDPLYIKKICLEKVTEWNKFTERDIYVKQILSGLTNQ
LFEVGLKEFSVSQNPSIRKHILFRIYGKDVGELYNTDIEIEVYETMSKYKISPKLLNTFS
GGRIEEWLYGNPLKTEDLQNSKILIAIANMLGKFHTLAIKKTLPSHWDKTPCIYKRIQEW
KIQLSKLKNIDKFKGDINKYYQESDKFIKFMNKYTKEDSIRNHITFCHNDLQENNIINTN
NCLRLIDFEYAGYNFIATDIAIFFIETSIDYSTDTYPFYEINKNQYISYEKRKLFINEYL
SIYLGKSQIPYDQKVADSILDAIEIHALGANLLWGFWSIIRGYQVKCYNEFDFFLYAQDR
FKLYDEQKAYLLSKNLIPDYD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggaagataataataacagatcaaataatattgaaaatggacaaatagacttattaaat
tgtaacaataataacaatgaagatataaaattattgaaaattgaaaaaattttaagttat
gacgatttggaagcgtttaattctattcaattaaatcaagaaactgaaatattagctacg
ccatttcgatcccaagaaattaatttgaaaaatgatattccgttatgtgctcaagaattt
tctgatttaacagatccattatatattaaaaaaatatgtttagaaaaagtcacagaatgg
aataaatttactgaaagagatatatatgttaaacaaatattaagtggattaacaaatcaa
ttatttgaagtcggattaaaagaattttcggttagtcaaaatccatcaataagaaaacat
attttatttagaatatatggaaaagatgttggtgaattatataatacagacatagagatt
gaagtatatgaaacgatgagtaaatataaaatatctccaaaactattaaacacattttcc
ggtggtcgtatagaagaatggttatatggaaatcctttaaaaactgaggatttacaaaat
tcaaaaatattaattgccatagctaatatgttaggtaaatttcatacattagctattaaa
aaaactttaccaagtcattgggataaaacaccatgcatttacaaaagaatacaagaatgg
aaaatacaactttctaaattaaaaaatatagataaatttaaaggtgatataaataaatat
tatcaagaatctgataaatttattaaatttatgaataaatatacaaaagaagatagtatt
aggaatcatataactttttgtcataatgatttacaagaaaataatattataaatacaaac
aattgtttacgactaattgattttgaatatgctggatataatttcatagctacagatata
gcaatattttttatcgaaacatctattgattattctacagacacttatcctttttatgaa
ataaataaaaatcaatatatatcatatgaaaaaagaaaattgtttattaatgaatattta
tcaatttatttaggaaaatcacaaataccgtatgatcaaaaagttgccgactcaatttta
gatgcaattgaaattcacgcattaggtgctaacttattatggggattctggtcgattatt
cgaggttatcaagtaaaatgttataatgaatttgattttttcctatatgcgcaagatcga
tttaaactgtatgatgaacaaaaggcatatttactttcaaaaaatcttattccagactat
gattaa

DBGET integrated database retrieval system