KEGG   Plasmodium yoelii: PY00546Help
Entry
PY00546           CDS       T01035                                 

Definition
ubiquitin specific protease 5
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PY00546
Peptidases [BR:pyo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PY00546
Exosome [BR:pyo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PY00546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 835 aa AA seqDB search
MADIKNIISLISSTIKEPTKEDIIYLGECSITGHKDIFEDGVFIDLISFESFSLRNLKVN
CARRNNSVTMDEHRFYLNIKKKKKVLENVEEKEIKNLNINAEGGFIDNKVYEYEYDYFVY
DIKTNIYIKLSDLDQNVINICNNIINHKNEIKKDNINKWINEIKESKYSKDLIQLPNIKI
KNENIECAVCKSKKNLWLNLSDGYIGCGRKIYNYGGGCLNNEEGAALKHFYETGKKYPLV
VKIGTITKDGNADVFSYADDENDSVIDPYIATHLNNLGINIMNLEKTEITTLEKEIQENK
NINFSSILDKGIEPICEQGKIGFINLGNTCYMNCALQVLLSIKGISLKYINNLDNFLLTL
DRSNKTHDDLFLQYSKLCYMAYQEDYIKNKKKYVKQFKQECQNKNIKINYDSDVDEENSV
SIDPSMFRNCVNKKGNNNFCNNNQQDIYEYLSYIINELIDNENKIFDRLSNNKTNINAET
NKRKHEEIDNVTNKQENDEKNVNPYFPFDSDTILNIDKSIFNYFTFEIEQTIQSDIGNKS
VSSFQNIILSLDIPVDNSLLKELEKEQNEHDKTTGSENIKITLMDCLKNYIKKDNINDYY
SEIENKKVHAQKDTKFKSFPPYLFIHIKRFYADENWCAKKINIPIEAHDKMNLEFMRADK
NTNLDKNTHTNNICNNENSEQNILEKYKDVVDSLLDLGFEKDKIIESIKKVKIKNVNNCI
SYIYGEDSVELDNTQSSNNNNTEINQNNLDSIISMGISKEVAMASLLINKNDLQKSIDYI
FSNMDILTENKCNAIINSNKCDDGLANYELVASIVHIGNNANSGHYICYIKDNSK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggctgatattaaaaacatcatatctctgatttctagtactataaaagagccaaccaaa
gaagatataatttatttaggagaatgcagtataacgggccataaggacatatttgaagat
ggggtttttatcgatttgatatcttttgaaagtttcagtttaagaaatctgaaagtaaat
tgtgctcgaagaaataattcagtaacaatggatgaacatagattttatttaaatataaaa
aagaaaaaaaaagtgttagaaaatgttgaagaaaaagaaataaaaaatttaaacattaat
gcagaaggagggtttattgataacaaagtttatgaatatgaatatgattattttgtttat
gatataaaaacaaatatatatataaaattaagtgatttagatcaaaatgtaataaatata
tgtaataacataataaatcataaaaatgaaataaagaaagataatataaataaatggatt
aatgaaataaaagaaagtaaatattcaaaagatttaatacaattacctaatataaaaata
aaaaatgaaaatattgaatgtgcagtatgtaaatcaaaaaaaaatttatggttaaattta
tctgatggatatattggatgtggccgaaaaatttataactatggaggtggatgcttaaat
aatgaagaaggagctgctttaaaacatttttatgaaacagggaaaaaataccctttagtt
gttaaaataggaactataacaaaagatggaaatgctgatgttttttcatatgcagatgat
gaaaatgatagtgtaatagatccatatattgctactcatttaaataatctaggtataaat
ataatgaatttagaaaaaacagaaattactactttagaaaaagaaattcaagagaataaa
aatattaatttctcatcaatattagataaaggaatagaacctatttgtgaacaaggaaaa
atcggatttataaatttaggaaatacatgttatatgaattgtgcattacaagttttgttg
tctataaaaggaataagtttaaaatatataaataatttggataatttcttattaacctta
gatagaagtaataaaacacatgatgatctatttttgcaatattctaaactttgttatatg
gcttatcaagaagattatattaaaaacaaaaaaaaatatgttaaacaatttaaacaagaa
tgccaaaataaaaatattaaaattaattatgatagtgatgttgatgaagaaaattctgtt
agtattgatccgagtatgtttagaaattgtgttaataaaaagggaaacaacaatttttgt
aataacaatcaacaagatatatatgaatatctttcttatataataaacgaattaatagac
aatgaaaataaaatattcgatagattatcaaacaataaaacaaacataaatgcagaaacg
aataaaagaaaacatgaagaaatagataatgtaacaaataaacaagaaaatgatgagaaa
aatgtaaacccttatttcccttttgattcggatactattttaaatatagataaatctatt
tttaattatttcacttttgaaatcgaacaaacaatacaaagtgatataggaaataaaagt
gtgagctcttttcaaaacatcatattgtctttagatataccagttgataattcgttgtta
aaagaattggaaaaagaacaaaatgaacatgataaaactacagggtcagaaaatattaaa
atcactttaatggattgcttaaaaaattatataaagaaggataatataaatgattattac
tcagaaatagaaaataaaaaagtacatgcccaaaaagataccaagtttaaatctttccca
ccatatctttttattcatattaaaagattttatgctgatgaaaattggtgtgctaaaaaa
attaatatacctattgaagctcatgataaaatgaatctagaatttatgagagctgataaa
aatacaaatttggataaaaacacacacactaataacatatgtaacaatgaaaatagtgaa
caaaatattcttgaaaaatataaagatgttgttgattcattattagatctaggttttgaa
aaagataaaataatcgaatcaattaaaaaagtaaaaataaaaaatgtaaataattgtata
tcttatatatatggtgaagattctgtagaattagataatactcaatcaagtaataataat
aataccgaaataaatcaaaacaatttagattcgattatttcgatgggaataagtaaagaa
gtggctatggcttctcttttaataaataaaaatgatctccaaaagtcaattgattatatt
ttttcaaatatggatatactcacagaaaataaatgcaatgcgattataaacagcaacaaa
tgtgacgatggattggcaaactacgaattggtagcatcaattgtacacataggaaataat
gcaaattcaggtcactacatatgttatatcaaagataattcaaagtaa

DBGET integrated database retrieval system