KEGG   Plasmodium yoelii: PY17X_0716100Help
Entry
PY17X_0716100     CDS       T01035                                 

Gene name
PY00546
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 13, putative
  KO
K11836  ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PY17X_0716100 (PY00546)
Peptidases [BR:pyo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PY17X_0716100 (PY00546)
Ubiquitin system [BR:pyo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    PY17X_0716100 (PY00546)
Exosome [BR:pyo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PY17X_0716100 (PY00546)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH zf-UBP UCH_1 UBA_3 NusG
Motif
Other DBs
NCBI-GeneID: 3790547
NCBI-ProteinID: XP_022811819
Position
7
AA seq 864 aa AA seqDB search
MADIKNIISLISSTIKEPTKEDIIYLGECSITGHKDIFEDGVFIDLISFESFSLRNLKVN
CARRNNSVTMDEHRFYLNIKKKKKVLENVEEKEIKNLNINAEGGFIDNKVYEYEYDYFVY
DIKTNIYIKLSDLDQNVINICNNIINHKNEIKKDNINKWINEIKESKYSKDLIQLPNIKI
KNENIECAVCKSKKNLWLNLSDGYIGCGRKIYNYGGGCLNNEEGAALKHFYETGKKYPLV
VKIGTITKDGNADVFSYADDENDSVIDPYIATHLNNLGINIMNLEKTEITTLEKEIQENK
NINFSSILDKGIEPICEQGKIGFINLGNTCYMNCALQVLLSIKGISLKYINNLDNFLLTL
DRSNKTHDDLFLQYSKLCYMAYQEDYIKNKKKYVKQFKQECQNKNIKINYDSDVDEENSV
SIDPSMFRNCVNKKGNNNFCNNNQQDIYEYLSYIINELIDNENKIFDRLSNNKTNINAET
NKRKHEEIDNVTNKQENDEKNVNPYFPFDSDTILNIDKSIFNYFTFEIEQTIQSDIGNKS
VSSFQNIILSLDIPVDNSLLKELEKEQNEHDKTTGSENIKITLMDCLKNYIKKDNINDYY
SEIENKKVHAQKDTKFKSFPPYLFIHIKRFYADENWCAKKINIPIEAHDKMNLEFMRADK
NTNLDKNTHTNNICNNENSEQNILEKYKDVVDSLLDLGFEKDKIIESIKKVKIKNVNNCI
SYIYGEDSVELDNTQSSNNNNTEINQNNLDSIISMGISKEVAMASLLINKNDLQKSIDYI
FSNMDILTENKCNAIINSNKCDDGLANYELVASIVHIGNNANSGHYICYIKDNSKWYIFN
DNKVGLCNENLGKDTAYIHLYKRI
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggctgatattaaaaacatcatatctctgatttctagtactataaaagagccaaccaaa
gaagatataatttatttaggagaatgcagtataacgggccataaggacatatttgaagat
ggggtttttatcgatttgatatcttttgaaagtttcagtttaagaaatctgaaagtaaat
tgtgctcgaagaaataattcagtaacaatggatgaacatagattttatttaaatataaaa
aagaaaaaaaaagtgttagaaaatgttgaagaaaaagaaataaaaaatttaaacattaat
gcagaaggagggtttattgataacaaagtttatgaatatgaatatgattattttgtttat
gatataaaaacaaatatatatataaaattaagtgatttagatcaaaatgtaataaatata
tgtaataacataataaatcataaaaatgaaataaagaaagataatataaataaatggatt
aatgaaataaaagaaagtaaatattcaaaagatttaatacaattacctaatataaaaata
aaaaatgaaaatattgaatgtgcagtatgtaaatcaaaaaaaaatttatggttaaattta
tctgatggatatattggatgtggccgaaaaatttataactatggaggtggatgcttaaat
aatgaagaaggagctgctttaaaacatttttatgaaacagggaaaaaataccctttagtt
gttaaaataggaactataacaaaagatggaaatgctgatgttttttcatatgcagatgat
gaaaatgatagtgtaatagatccatatattgctactcatttaaataatctaggtataaat
ataatgaatttagaaaaaacagaaattactactttagaaaaagaaattcaagagaataaa
aatattaatttctcatcaatattagataaaggaatagaacctatttgtgaacaaggaaaa
atcggatttataaatttaggaaatacatgttatatgaattgtgcattacaagttttgttg
tctataaaaggaataagtttaaaatatataaataatttggataatttcttattaacctta
gatagaagtaataaaacacatgatgatctatttttgcaatattctaaactttgttatatg
gcttatcaagaagattatattaaaaacaaaaaaaaatatgttaaacaatttaaacaagaa
tgccaaaataaaaatattaaaattaattatgatagtgatgttgatgaagaaaattctgtt
agtattgatccgagtatgtttagaaattgtgttaataaaaagggaaacaacaatttttgt
aataacaatcaacaagatatatatgaatatctttcttatataataaacgaattaatagac
aatgaaaataaaatattcgatagattatcaaacaataaaacaaacataaatgcagaaacg
aataaaagaaaacatgaagaaatagataatgtaacaaataaacaagaaaatgatgagaaa
aatgtaaacccttatttcccttttgattcggatactattttaaatatagataaatctatt
tttaattatttcacttttgaaatcgaacaaacaatacaaagtgatataggaaataaaagt
gtgagctcttttcaaaacatcatattgtctttagatataccagttgataattcgttgtta
aaagaattggaaaaagaacaaaatgaacatgataaaactacagggtcagaaaatattaaa
atcactttaatggattgcttaaaaaattatataaagaaggataatataaatgattattac
tcagaaatagaaaataaaaaagtacatgcccaaaaagataccaagtttaaatctttccca
ccatatctttttattcatattaaaagattttatgctgatgaaaattggtgtgctaaaaaa
attaatatacctattgaagctcatgataaaatgaatctagaatttatgagagctgataaa
aatacaaatttggataaaaacacacacactaataacatatgtaacaatgaaaatagtgaa
caaaatattcttgaaaaatataaagatgttgttgattcattattagatctaggttttgaa
aaagataaaataatcgaatcaattaaaaaagtaaaaataaaaaatgtaaataattgtata
tcttatatatatggtgaagattctgtagaattagataatactcaatcaagtaataataat
aataccgaaataaatcaaaacaatttagattcgattatttcgatgggaataagtaaagaa
gtggctatggcttctcttttaataaataaaaatgatctccaaaagtcaattgattatatt
ttttcaaatatggatatactcacagaaaataaatgcaatgcgattataaacagcaacaaa
tgtgacgatggattggcaaactacgaattggtagcatcaattgtacacataggaaataat
gcaaattcaggtcactacatatgttatatcaaagataattcaaagtggtacatatttaat
gataataaggttggattatgcaatgaaaatttgggaaaggatacagcatatatccattta
tacaaaaggatataa

DBGET integrated database retrieval system