KEGG   Plasmodium yoelii: PY17X_0703100Help
Entry
PY17X_0703100     CDS       T01035                                 

Gene name
PY00638
Definition
(RefSeq) protein disulfide isomerase, putative
Organism
pyo  Plasmodium yoelii
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 AhpC-TSA Glutaredoxin Calsequestrin OST3_OST6 TraF HyaE Sir1 Es2
Motif
Other DBs
NCBI-GeneID: 3791256
NCBI-ProteinID: XP_725916
Position
7
AA seq 482 aa AA seqDB search
MNTKYISFLLFLIPFVFKNYVRSHEDLFNEHITSIHDGELSNFITKNDIVLVMFYAPWCG
HCKRLIPEYNEAAIMLSEKKSEIKLASVDATIERGLSQEYGITGYPTMILFNKKNRINYG
GGRTAQTIVDWILQMTGPVSTEITGNIEDVLKEKNINVAFYMEYTSEDNELFKMFNEVGD
KNREIAKYFMKKNDKHNKIYCYRKDEKTVEYDEKTPLNDFVSIESFPLFGEINTENYRFY
AESPKELVWVCATVEQYNEIKEEVRLAAAELRNKTHFVLLNIPEYADHAKASLGINEFPG
LAYQSSEGRYLLTNPQQSLKNHKDIISFFKDVEAGKIEKSLKSEPIPEEDKNAAVKVVVG
NSFIDVVLNSGKDVLIEIYAPWCGHCKKLEPVYEELGRKLKKYDHIIVAKMDGTLNETAL
KEFEWSGFPTIFFVKAGSKIPLPYEGERTLKGFVDFLNKHSTKTPITIDGVSQSDEGSSE
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaaatatatttcttttttactatttctaattccctttgttttcaaaaattat
gttcgatctcatgaggatctttttaacgaacatataacaagcatacatgatggagaatta
agtaatttcataacaaaaaatgatatcgtactagttatgttttacgccccatggtgtgga
cattgcaaacgattaatccccgaatacaacgaagcagctattatgctttctgaaaagaaa
agtgaaatcaaattggcaagtgttgatgccactattgaaagaggtctttctcaagaatat
ggaattactggatacccaactatgattttatttaataaaaagaatagaataaattatgga
ggtggccgaacagctcaaactattgtagattggatacttcaaatgactgggcctgtatct
acagaaataacaggaaatatagaagatgttttaaaagaaaaaaatataaatgttgcattt
tatatggaatacacttcagaagataatgaattatttaaaatgtttaatgaagttggagat
aaaaatcgtgaaattgcaaaatattttatgaaaaaaaatgataaacataataaaatatat
tgttatagaaaagatgaaaaaacagtcgaatatgatgaaaaaactccattaaatgatttt
gtatcaattgaatcatttcctttatttggtgaaattaatacagaaaattataggttttat
gcagaaagcccaaaagagttagtatgggtatgtgccacagttgaacaatacaatgaaata
aaagaagaagttagattagctgctgcagaattaagaaataaaacacatttcgttttgtta
aatataccagaatatgctgatcatgctaaggcctcattaggtataaatgaattcccaggt
ttagcttatcaatcaagtgaaggtagatatttattaacaaatccacaacaatctttaaaa
aaccataaagatataatttcattttttaaagatgttgaagctggaaaaattgaaaaatct
cttaaatcagaaccaataccagaagaagataaaaatgcagcagtaaaagttgtagttgga
aattcatttatagatgttgtattaaacagtggaaaagatgtacttatagaaatatatgct
ccatggtgtggacattgtaaaaaattagaacctgtttatgaagaacttggaagaaaatta
aaaaaatatgatcatataattgttgctaaaatggatggtacacttaatgaaacagcactt
aaagaatttgaatggtctggtttcccaactatattttttgttaaagctggatcaaaaata
cctttaccatatgaaggtgaaagaacattaaaaggatttgttgatttcttaaataaacat
tccactaaaactccaatcactattgatggtgtttcacaatctgatgaaggatcttctgaa
gaattataa

DBGET integrated database retrieval system