KEGG   Plasmodium yoelii: PY17X_0935700Help
Entry
PY17X_0935700     CDS       T01035                                 

Gene name
PY00731
Definition
(RefSeq) mitogen-activated protein kinase 2
Organism
pyo  Plasmodium yoelii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
9
AA seq 528 aa AA seqDB search
MLKKKKECSGIEREEKNTKKKNNASECLSMQNDDSTYIDSNEEDKNGEYINENTKENIKN
NDNINKKSDEKEYNASETKKTNNNEKNKNNSNNKTSKINDEKGKDEKINIKEAIIKNVRV
PDNYIIKHLIGRGSYGYVYLAYDKNTEKNVAIKKVNRMFEDLIDCKRILREITILNRLKS
DYIIRLYDLIIPEDLLKFDELYIVLEIADSDLKKLFKTPIFLTEEHIKTILYNLLLGEKF
IHESGIIHRDLKPANCLLNQDCSVKVCDFGLARTINSEKDVNIVNDLEENEEPGPHNKNL
KKQLTSHVVTRWYRAPELILLQENYTKSIDIWSTGCIFAELLNMLQSHINDPTNRFPLFP
GSSCFPLSPDRNSKKVHEKSNRDQLNIIFNIIGTPTEDDLKNIKKPEVIKYIKLFPHRKP
INLKQKYPSISDDGINLLESMLKFNPNKRITIDQALDHPYLKDVRKKNLENFSTKKIILP
FDDWMILSETQLRYIFLKEVQSFHPELVIPSAFTIHESNFYNNEEPSS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaaaaaaaagaatgctctggaattgaaagagaggaaaaaaatacaaaaaaa
aaaaacaatgcttcagaatgtttaagcatgcaaaatgatgatagcacatatatagatagc
aatgaagaagataaaaatggggaatacataaatgagaacacaaaagaaaatataaaaaat
aacgacaatattaataaaaagtctgacgaaaaggaatacaacgcatccgagacaaaaaaa
accaataataacgagaaaaacaaaaataatagtaacaataaaactagcaaaataaatgat
gagaaaggaaaagatgaaaaaataaatataaaagaagctattataaaaaatgtgcgtgta
ccagataattacataattaagcatttaataggaagagggtcgtatgggtatgtatattta
gcttatgataaaaatacagaaaaaaatgttgcaataaaaaaggtaaatcgaatgtttgaa
gatttaattgattgtaaaagaatattaagagaaataacaattttgaataggctaaaaagt
gattatattataagattatatgatttaataatacctgaagatttattaaaatttgatgaa
ttatatatagtattagaaatagctgattcagatttaaaaaaattatttaaaaccccaata
tttttgacagaagaacatataaaaactatattatataatttattattaggtgaaaaattt
attcacgaatcaggtattatccatagagatttaaaaccagctaactgtttattaaaccaa
gattgttctgttaaagtatgtgattttggtttagctagaacgataaatagtgaaaaagat
gttaatatagtaaatgatttagaagaaaatgaagaaccaggaccacataataaaaattta
aaaaaacaattaactagccatgtagttactagatggtatagagcccctgaattaatattg
ttacaagaaaattatactaaatctatagatatatggtctactggttgtatttttgcagaa
ctattaaatatgttacaaagccatattaatgatcccactaatagatttcctttatttcca
ggatcttcttgttttccactatctccagaccgtaattcaaaaaaagtacatgagaaaagt
aatagagaccaattaaatattatttttaatatcataggtacacctacagaagatgatctt
aaaaatattaaaaaacctgaagttataaaatatattaaattgttcccgcacagaaaacct
ataaatctaaagcaaaaatacccatctatttcagatgatggaatcaatttattagaatca
atgttaaaatttaatccaaataaaagaatcacaattgaccaagctttagatcatccttat
ctaaaagatgttagaaaaaaaaatttagaaaatttctcaacaaaaaaaattattcttcct
tttgatgattggatgattttatctgaaacacaattgagatatatatttttaaaagaagtg
caatcctttcatcctgaattagttataccttctgcatttactatacacgaaagtaatttc
tataacaatgaggaacctagtagttaa

DBGET integrated database retrieval system