KEGG   Plasmodium yoelii: PY00731Help
Entry
PY00731           CDS       T01035                                 

Definition
mitogen-activated protein kinase 2
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PY00731
Protein kinases [BR:pyo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PY00731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 528 aa AA seqDB search
MLKKKKECSGIEREEKNTKKKNNASECLSMQNDDSTYIDSNEEDKNGEYINENTKENIKN
NDNINKKSDEKEYNASETKKTNNNEKNKNNSNNKTSKINDEKGKDEKINIKEAIIKNVRV
PDNYIIKHLIGRGSYGYVYLAYDKNTEKNVAIKKVNRMFEDLIDCKRILREITILNRLKS
DYIIRLYDLIIPEDLLKFDELYIVLEIADSDLKKLFKTPIFLTEEHIKTILYNLLLGEKF
IHESGIIHRDLKPANCLLNQDCSVKVCDFGLARTINSEKDVNIVNDLEENEEPGPHNKNL
KKQLTSHVVTRWYRAPELILLQENYTKSIDIWSTGCIFAELLNMLQSHINDPTNRFPLFP
GSSCFPLSPDRNSKKVHEKSNRDQLNIIFNIIGTPTEDDLKNIKKPEVIKYIKLFPHRKP
INLKQKYPSISDDGINLLESMLKFNPNKRITIDQALDHPYLKDVRKKNLENFSTKKIILP
FDDWMILSETQLRYIFLKEVQSFHPELVIPSAFTIHESNFYNNEEPSS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaaaaaaaagaatgctctggaattgaaagagaggaaaaaaatacaaaaaaa
aaaaacaatgcttcagaatgtttaagcatgcaaaatgatgatagcacatatatagatagc
aatgaagaagataaaaatggggaatacataaatgagaacacaaaagaaaatataaaaaat
aacgacaatattaataaaaagtctgacgaaaaggaatacaacgcatccgagacaaaaaaa
accaataataacgagaaaaacaaaaataatagtaacaataaaactagcaaaataaatgat
gagaaaggaaaagatgaaaaaataaatataaaagaagctattataaaaaatgtgcgtgta
ccagataattacataattaagcatttaataggaagagggtcgtatgggtatgtatattta
gcttatgataaaaatacagaaaaaaatgttgcaataaaaaaggtaaatcgaatgtttgaa
gatttaattgattgtaaaagaatattaagagaaataacaattttgaataggctaaaaagt
gattatattataagattatatgatttaataatacctgaagatttattaaaatttgatgaa
ttatatatagtattagaaatagctgattcagatttaaaaaaattatttaaaaccccaata
tttttgacagaagaacatataaaaactatattatataatttattattaggtgaaaaattt
attcacgaatcaggtattatccatagagatttaaaaccagctaactgtttattaaaccaa
gattgttctgttaaagtatgtgattttggtttagctagaacgataaatagtgaaaaagat
gttaatatagtaaatgatttagaagaaaatgaagaaccaggaccacataataaaaattta
aaaaaacaattaactagccatgtagttactagatggtatagagcccctgaattaatattg
ttacaagaaaattatactaaatctatagatatatggtctactggttgtatttttgcagaa
ctattaaatatgttacaaagccatattaatgatcccactaatagatttcctttatttcca
ggatcttcttgttttccactatctccagaccgtaattcaaaaaaagtacatgagaaaagt
aatagagaccaattaaatattatttttaatatcataggtacacctacagaagatgatctt
aaaaatattaaaaaacctgaagttataaaatatattaaattgttcccgcacagaaaacct
ataaatctaaagcaaaaatacccatctatttcagatgatggaatcaatttattagaatca
atgttaaaatttaatccaaataaaagaatcacaattgaccaagctttagatcatccttat
ctaaaagatgttagaaaaaaaaatttagaaaatttctcaacaaaaaaaattattcttcct
tttgatgattggatgattttatctgaaacacaattgagatatatatttttaaaagaagtg
caatcctttcatcctgaattagttataccttctgcatttactatacacgaaagtaatttc
tataacaatgaggaacctagtagttaa

DBGET integrated database retrieval system