KEGG   Plasmodium yoelii: PY00756Help
Entry
PY00756           CDS       T01035                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pyo  Plasmodium yoelii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pyo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pyo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pyo00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pyo00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pyo00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 300 aa AA seqDB search
MLKLFWGICIFLMTIECMKYNYKNSNNLFNNHKINKKPFFIKSRLPLDKIKDNHTYDIKT
WTKLGIKRYTNKKNNEVYSFINNKNINLETEIGRKKIIIANWKCYLLKEKAYKLIDKLTQ
IKFSNYIDVIVSPNLLFLPYLHEKIKKNDSKIFPCSQDVSLVNGLGAFTGETTASLLREF
GINYTIIGHSERKKSFFNVGENIEQTALKVYNAINSKLKVILCVGENYTSRECSFPFQKF
RELLSLIKQKIPKEEIKNIIIAFEPRFAVGTGNPVSSSNLNNCCFGILKKSKFIKYHKVM
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaattattttgggggatatgcatttttctaatgaccattgaatgcatgaaatat
aattataaaaattcaaataacttatttaacaatcataaaataaacaagaaaccatttttc
attaaatcaaggttaccactagataaaataaaagataatcacacatatgatataaaaaca
tggacaaaattgggaataaagcgctataccaataaaaaaaataatgaggtatactcattt
ataaataacaaaaatataaatttagagacagaaattgggaggaaaaaaattatcatagct
aactggaaatgttatttgttaaaagaaaaagcatataaactaatcgacaaattaacacaa
attaaattttcaaattatattgatgtaattgtatccccaaatttattatttttaccttat
cttcatgaaaaaataaagaaaaacgattcaaaaatatttccgtgttctcaagatgtaagc
ttagtaaatggcttaggggcttttacaggggaaacaacagcaagtttgctacgtgaattt
ggaataaattatacaataataggacatagtgaaagaaaaaagagtttttttaatgttggt
gaaaacattgaacaaacggcattgaaagtatataatgcaattaattccaagttaaaagtt
attttatgtgtaggagaaaattacacaagtagggaatgcagtttcccttttcaaaaattt
agggaattgctttctctaattaagcaaaaaatcccaaaagaagaaattaaaaatattatt
atagcctttgagcccagatttgctgtaggaactgggaatcctgtatcatcgtccaatcta
aataattgttgttttggtattcttaaaaaatcaaaatttataaaatatcataaagtgatg
taa

DBGET integrated database retrieval system