KEGG   Plasmodium yoelii: PY00935Help
Entry
PY00935           CDS       T01035                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pyo  Plasmodium yoelii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PY00935
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PY00935
Exosome [BR:pyo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PY00935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 501 aa AA seqDB search
MNIILSIDQSTQSTKLIFFDEELKVLHMNSLNHEQKCFKPGWYEHDPEEIIENLYKLMNE
GINVLKEKYKTVVIKCIGITNQRETVIIWDKETGKPLYNAIVWLDTRVESLVTEFSKKYN
NDYFQKKTGTYFNTYFSAFKILWLIKNNKTIKEKVKNGTAMIGNINTWLIYNLTKGNCYT
DVTNASRTLLMDINTLQWDPEMCKMFGITNMSALPEIKCNCYNFGLVKSEKVPDYSNVPI
TGCIGDQQSACIGQAIFDEGEAKCTYGTGVFLLVNTGNKIVYSSCGLITTVCYKFNDDDK
PNYALEGSIGTAGSGVSWLENVNLIKDTSEVNEIMETCKDTEGVVFVPAFGGLFAPRWRS
DARACISGMSFNTSKAHIVRALLEGIVFQLSEIVNSLTSDMNIEMIHLLRCDGGMTKNKA
FMQFNADILNTNIEVSKYKEVTALGAAVLAGLGIKLWKDLDSVKSLIRNKEYTFNSNMDA
KSRSKKIKEWNKAVNKELLES
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatattaagtatagaccaaagtactcaatccactaagttaatcttctttgat
gaagaattaaaagtgttgcatatgaacagcttaaatcatgaacagaaatgttttaagcca
ggttggtatgaacatgatccagaagaaataattgagaatttatataaattaatgaatgaa
ggaataaatgttttaaaagaaaagtataaaacagttgtaataaaatgtataggtattact
aaccaacgagaaactgttataatatgggataaagaaactggtaagcctttatataatgca
atcgtttggctagatacaagagtagaaagtcttgttacggaattttctaaaaagtataac
aatgattattttcagaaaaaaacaggtacatattttaatacatattttagtgcttttaaa
atattatggttaataaaaaataataaaactataaaggaaaaggtaaaaaatggtacagct
atgattggaaatataaatacatggttgatttataatttaactaaaggcaattgttataca
gatgtaacaaacgcatctcgaacacttttaatggatatcaatacattacaatgggatcca
gaaatgtgcaaaatgtttggtattactaacatgtctgctttacccgaaataaaatgtaat
tgttataattttggtttagtaaaatcagaaaaagtgccagactattcaaatgttccaatt
actggttgtataggtgatcaacaaagtgcatgtataggtcaggcaatttttgatgaagga
gaagcaaagtgtacatatggaactggtgttttcttattagttaatacaggaaataaaatc
gtatattcttcatgtgggctaattacaacagtttgttataaatttaatgatgatgacaaa
ccaaattatgctcttgaaggttcaataggtacagctggatcaggtgtatcatggttagaa
aatgttaatttaattaaagacacatctgaagtaaatgagattatggaaacttgtaaagac
accgaaggagttgtatttgttccagcttttggtggtttatttgctccaagatggagatca
gatgctagagcatgtataagtggaatgtcttttaatacaagcaaagcacatattgttaga
gccttattagaaggtatagttttccaattaagtgaaatcgtaaattcactaacatctgat
atgaatatagaaatgattcatcttttgagatgtgatggaggaatgactaaaaataaagcc
tttatgcaatttaatgcagacatattaaatacaaatattgaagtatccaaatataaagaa
gtaacagctcttggtgctgctgtattagctggtttaggaattaaactatggaaggattta
gacagtgttaaaagtttaataagaaataaggaatatacatttaattccaatatggatgct
aagagtcgaagcaagaaaattaaagaatggaataaagccgttaataaagaattgttagaa
tcataa

DBGET integrated database retrieval system