KEGG   Plasmodium yoelii: PY01242Help
Entry
PY01242           CDS       T01035                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
pyo  Plasmodium yoelii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2033 aa AA seqDB search
MSKQYVHISKEDNLNDQIDVIRTNYSQNNILRNRDKYIDEKRGRHNGKDKDKFREKDRMK
YRDKISYTNYIDNKHKYKKNYLENHDQVYNNYPIEEYDDDDDNNNYSSEDEKREKGFKKI
YNKNEKKYLDGIILNKNYDEPINNVLKKKNHKNEEKENNNFFQKNNDNNSTVNNNSGYAT
KGLGFFSSNFFHLKRLLEKKNVETNDSLKRENELDKFYEKNEKKKSSSFDIFQKLINNKT
HDMKCEKMSNSYKRESNDYSDMYYTSREKENLKKYIYPNDTPQISDAYNDYIEHFGIDKY
EKFQTYKGNKSDKDRTYYKDRCESHENGKNGKNEKNEKNEKNEKSEKNSKNSKNKKRAEC
KSKKINKELLNDRIQNIEYDDKSLKFQKKYISNLTRTYSNEMLLNNFSVDKLDHQFNNGD
ENYENCENYENYENYENYENNENNENSESFLYSVDNFKIVKNILLSLELTNDNKISKIRK
ILFYSPSEEKKKIMDEILNTLYMYPQLYVSCIISLFYLFILDNDLFERNFSSKDLVYLFN
PKIDFRYAEWFLKTYLFYKFKFSNYSNSDDEHNSYICENSSVGKENVANTEKGRIEKDRI
EKGRIERGEEANSLVSEKDDIEENEKKQKIKNTIYDKFFESYSSSGDSMDNYIYYKNGKN
GKNCNDKNYEPNKELEKKIDKTWNKIEINEYVGYNECKMLLKICLSNEKVQNIKLLSESK
IRSLVISIWLNIRCSRPKKYFFKLIYNWINNKNDNFNKKKNLFNLLKEEKKYNKNITKVC
FSYFLQFLIKYKENCSNDIIYTLYLIDENELKLHSKKFIEKNKININKFISIWNIMCILF
WDTKKIHNFTFFKKNNNNYYYDFMLIFLKNFYEYIFPANAQIFQNAYLKKTINFNSISTT
NLINQPHNKPSSKISSKLSSKMSSKMSSKLSSKLSSKLSSKMSSKLSSSYPEPQNYNDES
DNFDLFDVENIIKYFDFNDVSNIDINTKNFTSSQSRDNNPDSLGTNHSETIESENANGIK
NMLKFIIQKIKKEKNIISCVDINEIIMLVFLGICIKIVICRISNLLNSKTCLEQFYYFIN
HKILGLRKFKYSHIVLIYFIPFFKKYYFLWKFIEHEIDPEIIKLINAIINNLENLQINKN
INNIENNSKLHPYIRSNTSLPEIDHLSFPLKNNKLNNRFTNLNIQSNPHYYKTNFSHTPS
IESNNNNNNNLKQNNISFSSDMLISDPFNVKNKKNXKIKKKNSENSKNSENSENSKNSEN
SEKIGDTHSNVTHGYSNGYFELGCQNKNVHKNVHKNVNNNINYLQSNSLFKLNENCDQGI
TYDDMFRNEDENDEDENENDENENDENDGNYFDKNKNKTRNVKEYITNLHFNNLPDYLTC
LKSGNANKKKKKKKIKDQYQSQSQSQSQGQSKNSKEQENEEGENKNTSKLIGQNEDIPFY
YISDNENSGNKISKTGNPARKYLLNNFEENKYKQNNKLNIHKNNGISKFPTISYEDVENS
NNMIDTKTQNNYLDLEMNRRKKESFSSSKRLTNIESVKGFNSDNGGDNNDDDNDENDGEA
INSRKRGQASEHIGNYIRNHNNIKSKECEQFLREQNKKKELEISQKKGIYIVNSTTNNNY
EEINIINNNTEKKKQINSDLLVQKRPKYLMLPINMIELKKMQKGKLRHPPVGLMNLGNTC
YLNSLLQALYSTVSFVVNLYIFNIDDNEKIMYSNHQNVSNKMSIKNKLFFSSNINDSHKN
LLSKRFLYELKILFKLMSKTNKKYISPDNILNILPQELNNKNQQDVTELFRYTFEQLGGS
EKKFLRLIFSGVVIQKVQCQKCFFISKKEEIIHDLSFHVPAKSTKKESIQKFFDTYIQKE
KIYGNNKYKCSKCNKRRNALKWNEIISPPCHLILILNRYNWSFSSNEKKKIKTHVKINKK
IVVNNFDYRLYGGIIHSGVSASSGHYYFIGKKSEKCDNFKNEWYQMDDSVITKVSSKSIN
RISKDLSNDHTPYVLFYRCKQAPVAASFAEVAVSFAKVLTNFISSIFLNPNPF
NT seq 6102 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacaatatgttcatatttcaaaagaagataatttaaatgaccaaatagatgtt
ataagaacaaattattctcaaaataacattttacgaaatcgagacaaatatatagatgaa
aaaagaggaagacataatggaaaagataaagataaatttagagaaaaagatagaatgaaa
tatcgagataaaattagttatacaaattacatagataataaacataaatataaaaaaaat
tatttagaaaatcatgatcaagtatacaacaattacccaatagaagaatatgatgatgat
gatgataataacaattatagtagtgaagatgaaaaaagagaaaaggggtttaaaaaaata
tataataaaaatgaaaaaaaatatttagatggaattattttaaataaaaattatgatgaa
ccaattaataatgttttaaaaaaaaaaaatcataaaaatgaagaaaaagaaaataataat
ttttttcaaaaaaataatgataataattcaactgtaaataataatagtggttatgctaca
aaaggtcttggatttttttcgagtaatttttttcatttaaaaagattattagaaaaaaaa
aatgttgaaacaaatgattcattaaaaagagaaaatgaattagataaattttacgaaaaa
aatgaaaaaaaaaaatcaagttcatttgacatttttcaaaagcttataaataataagaca
catgatatgaaatgtgaaaaaatgtctaattcttataaaagagaaagtaatgattattca
gatatgtattacacttcaagagaaaaagaaaatttaaaaaaatatatatatcctaatgat
acaccacaaataagtgatgcctataatgattatatagaacactttggcattgataaatat
gaaaaatttcaaacatataaaggaaataaaagtgataaagaccgaacatattacaaagat
agatgtgaatctcacgaaaatggaaaaaatggaaaaaatgaaaaaaatgaaaaaaacgaa
aaaaacgaaaaaagcgaaaaaaatagtaaaaatagtaaaaataaaaaacgtgctgaatgc
aaatccaaaaaaataaataaagagttgttaaacgatcgaatccaaaatattgaatatgat
gataaatcattaaaatttcaaaaaaaatatatttcaaatttaactagaacatattcaaat
gaaatgttgctaaataacttttctgtcgataaattagatcaccagtttaataatggggat
gaaaattacgaaaattgcgaaaattacgaaaattacgaaaattacgaaaattacgaaaat
aacgaaaataacgaaaatagtgaaagctttttatattctgtagacaattttaaaattgtt
aaaaatatattattatctttagaattaacaaatgataataaaattagtaaaatacgaaaa
atattattttattctcctagtgaagaaaaaaaaaaaatcatggatgaaattttgaataca
ctttatatgtatccacaattatatgtatcttgtatcatttctttattctatttatttata
ttagataatgatttatttgaaagaaatttttcttctaaagatcttgtatatttattcaac
cctaaaatcgattttcgctatgctgaatggtttctaaaaacatatctcttttataaattt
aagttttcaaattattcaaattcagatgatgaacataatagttatatttgtgaaaatagc
tcagttggcaaagaaaatgtggcaaacactgaaaaaggcagaattgaaaaggacagaatt
gaaaaggggagaattgaaagaggggaagaggccaacagtttggttagcgaaaaagatgat
atagaagaaaatgaaaaaaaacaaaaaataaaaaataccatatatgataaattttttgaa
tcatatagttctagtggagattcaatggataactatatatattataaaaatggtaaaaat
ggtaaaaattgtaatgataaaaattatgaaccgaataaagagttggaaaaaaaaatagac
aaaacttggaataaaattgaaataaatgaatatgtaggatacaacgaatgtaaaatgtta
ttaaaaatttgtttatctaatgaaaaagttcaaaatataaaactattatcagaaagtaaa
ataagaagcttagttatttctatatggttaaatatccgttgttctagacccaaaaaatat
ttttttaaattaatatataattggataaataataaaaatgataattttaataaaaaaaaa
aatttatttaatttactaaaagaagaaaaaaaatataataaaaatataacaaaagtttgt
tttagttattttttacaatttttaataaaatataaagaaaactgttcaaatgatattata
tatacattatatttaatagacgaaaatgaattaaaattacattctaaaaaatttattgaa
aaaaataaaattaatattaataaatttatatctatttggaatataatgtgtatattattt
tgggatacaaaaaaaatacataattttacttttttcaaaaaaaataacaataattattat
tatgattttatgcttatctttttaaaaaatttctatgaatatatatttccagctaatgct
caaatctttcaaaatgcttatctaaaaaaaactattaattttaattctatctctactaca
aatttgataaatcaacctcataataaaccctcctcaaaaatttcttcaaaactgtcatca
aaaatgtcatcaaaaatgtcctcaaaactgtcatcaaaactgtcatcaaaactgtcatca
aaaatgtcatcaaaactgtcatcatcttatcctgagcctcaaaattacaatgacgaatca
gacaatttcgatctctttgatgttgaaaatattataaaatatttcgattttaacgatgtt
tccaatattgatattaatacaaaaaatttcacctcttctcaatctcgtgataataatccg
gattctctaggaactaaccactccgagacaatcgaatcagaaaacgcaaacggaataaaa
aatatgcttaaattcataatccaaaaaataaaaaaagaaaaaaatataatatcttgtgta
gatataaatgaaataataatgttggtatttttaggtatatgtataaaaattgttatttgt
agaatatcaaatttattaaattcaaaaacttgtttagaacaattttattattttataaat
cataagatattaggtttaagaaaatttaaatattctcatatagttttaatatattttatt
ccattttttaaaaaatattattttttatggaaatttattgaacatgaaatcgatccagaa
ataataaaattaataaatgcgattataaataatttggaaaatttacaaattaataaaaat
ataaataatattgaaaataattcaaaattacatccatatattcgtagtaatacatcatta
cctgaaattgatcatttatcttttcctttaaaaaataataaattaaataatcgttttact
aatctcaatattcagtctaatccacattattataaaacaaatttttctcatacaccatca
attgaaagtaacaataataataacaacaatcttaaacaaaataatatctcatttagttcg
gatatgttaatatctgatccctttaatgtaaaaaataaaaaaaatwaaaaaataaaaaaa
aaaaattcagaaaattcaaaaaattcagaaaactcagaaaattcaaaaaattcagaaaat
tcagaaaaaattggggatacacatagtaatgtaactcatggctattctaatggttatttc
gaattgggttgccaaaataaaaatgtccacaaaaatgtccacaaaaatgtaaataataat
attaactatttgcaatcaaactcgctatttaaattaaatgaaaattgtgatcagggcatc
acttatgatgatatgtttagaaatgaggatgaaaatgatgaagatgagaatgaaaatgat
gagaatgagaatgatgaaaatgatggcaattattttgataaaaataaaaataaaacccgc
aacgttaaggaatatattacaaacttgcattttaacaatttgccagattatttaacttgt
ttgaaaagtgggaatgccaataaaaaaaaaaaaaaaaaaaaaataaaagatcaatatcaa
agtcaaagtcaaagtcaaagtcaaggccaaagtaaaaattccaaggaacaggaaaatgaa
gagggagaaaataaaaacacttcaaagttaattggccaaaatgaagatatcccattttat
tatatttcagataatgaaaattcaggaaataaaatttcaaaaacgggaaatcctgctcga
aaatatttacttaacaattttgaagaaaataaatataagcaaaacaataaattaaatatc
cataaaaataatggaattagcaaatttcctaccatctcatatgaagatgttgaaaattca
aataacatgatcgatacaaaaacacaaaataattatctagatttagaaatgaatagaaga
aaaaaggaaagcttttcatcatcaaaaaggttaactaatattgaaagtgttaaaggtttt
aacagtgacaatggtggcgataataatgacgatgataatgatgagaatgatggcgaagca
attaatagtcgcaaacgtggccaagcaagtgagcatattggtaactatatcagaaatcat
aataacataaaatcaaaagagtgtgaacaatttttaagagaacaaaataaaaaaaaagaa
ctcgaaatatcacaaaaaaaaggaatatacattgtaaattctacaacaaataataattac
gaagaaataaatataattaataataatacagaaaaaaaaaaacaaattaattctgatcta
ttagtacaaaaacgacccaaatatttaatgttaccaattaacatgatagaattaaaaaaa
atgcaaaaaggaaaactaaggcatccccctgttggtctaatgaatttaggaaatacatgt
tatttgaatagtttattacaggcattatatagtactgtttcatttgttgttaacttatat
atttttaacattgatgataacgaaaaaataatgtattcaaatcaccaaaatgtatctaat
aaaatgtctatcaaaaataaattattttttagttcaaatataaatgatagtcacaaaaat
ttgctttcaaaacgatttttatatgaattaaaaatattatttaaattaatgtctaaaaca
aataaaaaatatatatctcctgataatattttaaatatacttcctcaagagcttaacaat
aaaaatcaacaagatgtcactgaattatttagatatacatttgagcaattaggtgggtcg
gaaaaaaagtttctaagattgatattttcaggagttgttatacaaaaagttcaatgtcaa
aaatgtttttttatttcaaaaaaagaagaaattattcatgatttatcgtttcatgttcct
gcaaaatcaaccaaaaaagaatctattcaaaaattttttgatacatatattcaaaaggaa
aaaatttatggaaataataaatataagtgctcaaaatgcaataaaagacggaatgctctt
aaatggaatgaaattatatcccccccttgtcatctcatattaattcttaacagatacaac
tggtcatttagctcaaatgagaaaaaaaaaataaagacccatgttaagattaacaaaaaa
atagttgtaaataacttcgattatagattatatggaggaataattcacagtggtgtgtca
gcatcatccggtcattattattttattggaaagaaatcagaaaaatgtgataattttaaa
aatgaatggtatcaaatggatgattcggttattactaaagttagttctaaatcaataaat
cgaatttctaaagatttatcaaatgaccatactccttatgttttattttatcgttgtaaa
caagctcccgttgcagctagctttgccgaggtagcagttagctttgctaaagttttaact
aattttatatccagtatattcctaaacccaaaccctttttaa

DBGET integrated database retrieval system