KEGG   Plasmodium yoelii: PY01620Help
Entry
PY01620           CDS       T01035                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pyo  Plasmodium yoelii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pyo03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 716 aa AA seqDB search
MVKVEESELSDKELVDFLSDDSDDGNETLLNKKYAGKEALITLETKFPKIVTILGIPKVE
EEKHSRLAEVLKKLFIRHLSAKISDSSIMNIKIYMPVDEEKKTKGICFVTFHDSFQANEA
VKVLNKLKLDAKHLLTASKMDDIENIINRDERVMPINVVGFTREKIRWWLYDEKCREQFI
VRYDTHFEVHWLDPLEKEPQLIYTTFKKNAPFSSVQWSNQGSYLVSFHNPGIALWGGDNF
EKLIRLQHKSVKDISFSPNENYVLTWDGTPASLRNEKSICIWRVITGKLLRSFITPEYSP
REKIFPHFLWSPDDKYIACIGKQKEVYIYELPSMLLLEDHEKKRTPLKYSVVKEFDWSPV
DNIVAIWIPETNNTPGTLILVEIPSRKELVSRKIYDVSQASIHWQSKGDYLCLKTTIVKK
IGKKGKKEHTQLEIFRMREKNIPVDNIQIEGVKTKQFHWEESNSNRFALIVRDEATSRQQ
IRFYKILNKGTTRNVKWTSTFDINNQMNFMKWSPQGTFFILASLLSEGMLYFCFLNSNDQ
VEVIHKDEHLLVNSVAWSNCGRYLVTSVSNLSGISSSNYKEENSETGFYVWTFQGRCLMT
IKKPSFFQFFFRPHPKSLFSDKLKIDIKNNLKDYSKKFDVIDEKIRNSKKNQLISERQNV
ENSFNEKLEKITKLFQSFKEYELFRRNWETFESQFEWEEKTIVIEHVLSVKQEIFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagttgaagaaagtgaattaagcgacaaagaacttgtcgattttttatctgat
gatagtgatgatgggaatgaaacattgttaaataaaaaatatgcaggaaaagaagctttg
attactcttgaaactaagtttcctaaaatagttacaatattgggtataccaaaagtagaa
gaagaaaaacatagtagattagccgaagttttaaagaaattatttataaggcatttaagt
gctaaaataagtgactcttcaataatgaatataaaaatttatatgcctgttgatgaagaa
aaaaaaacaaaaggaatatgttttgttacatttcatgatagttttcaagcaaatgaagca
gtaaaagtattaaataaattaaaattagatgcaaaacatttattaacagcatcaaaaatg
gatgatatagaaaatataataaatagagatgaacgtgtaatgcctataaatgttgttgga
tttacaagagaaaaaataagatggtggttatatgatgaaaaatgtagagaacaatttatt
gttagatatgatacccattttgaagttcattggttagacccattagaaaaagaaccacaa
ttaatttatactacatttaaaaaaaatgctccattttcaagtgttcaatggagtaatcaa
ggatcatacttagtcagttttcataatccaggtatagcattatggggtggagataatttt
gaaaaattaataagattacaacataaaagtgttaaagatataagtttttcacctaatgaa
aattatgtactaacttgggatggtactcctgcttcattaagaaatgaaaaatctatttgt
atatggagagtaataacaggaaaattgcttcgatcttttattacacctgaatatagtcca
agagaaaaaatatttcctcattttttatggagccctgatgataaatatattgcatgtata
ggaaagcaaaaagaagtatatatatatgaattaccatctatgttattattagaagatcat
gagaaaaaaagaaccccgttaaaatattctgtggttaaagaatttgattggtctcctgta
gataatatagttgcaatttggataccagaaacaaataatacacccggaactttgatatta
gtcgaaataccatcaagaaaagaattagtatctcgaaaaatttatgatgttagtcaggca
tctattcattggcaaagtaaaggagattatttatgtcttaaaacaactattgtaaaaaaa
attggaaaaaaaggaaaaaaagaacacacacaattagaaattttcagaatgagagaaaaa
aatatacctgtagataatatacaaattgaaggagtaaaaactaaacaatttcattgggaa
gaatcaaatagtaatagatttgcattaatagtaagagatgaagctacaagtagacaacaa
attagattttataaaatattaaataaaggtactactagaaatgttaaatggactagtact
tttgatataaataaccaaatgaattttatgaaatggtcaccacaaggaacattttttata
ttagcatctttattatcagaaggaatgttatatttctgttttttaaattcaaatgatcaa
gttgaagttatacataaggatgagcatttattagtaaattctgttgcatggagtaattgt
ggtagatacttagttacatctgtttctaatttatctggtatatcaagttctaattataaa
gaagaaaatagtgaaactggtttttatgtatggacatttcaaggtagatgtttaatgact
attaaaaaaccatcatttttccaatttttctttcgacctcatcctaaatcattatttagt
gataaattgaaaattgatataaaaaataatctaaaagattattctaaaaaatttgatgtt
atagatgaaaaaattcgaaattctaaaaagaaccaattaatttcagaaagacaaaatgtt
gaaaattcatttaatgaaaaattggaaaaaatcacaaaattattccaatcctttaaagaa
tatgaattgttcagaagaaattgggaaacatttgaaagccaatttgagtgggaagaaaaa
acaattgttattgaacatgtcctttctgtcaagcaagaaatctttgcatag

DBGET integrated database retrieval system