KEGG   Plasmodium yoelii: PY17X_1319200Help
Entry
PY17X_1319200     CDS       T01035                                 

Gene name
PY01623
Definition
(RefSeq) protein phosphatase 2b regulatory subunit, putative
Organism
pyo  Plasmodium yoelii
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
13
AA seq 177 aa AA seqDB search
MGNTHAILSEKDQKDLLQAARFSEMDIKKMYKRFLELDTNKNGQLDPNELFDVPEISDNP
LVKRVISIFDSNSDGKVSFVEFLVGITKLMSTTDDFQKKKFAFDIYDINKDGMISNGELF
TVMKMMVGNNLNDVQLQQLVDRTIIQADKDGDGMISFEEFKDMISHIDVGNKLKLDL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacacacgcaatattatctgaaaaagatcaaaaggatttgttgcaagctgct
cgttttagtgaaatggatattaaaaaaatgtataaaagatttcttgaacttgatacaaat
aaaaacggacaactagatccaaatgaattatttgatgttcctgaaataagcgataatcca
ctagtaaaaagagttatatcaatatttgattcaaattcagatggaaaagtatcatttgtt
gaatttttagttggaataacgaaattaatgtcaaccacagacgattttcagaaaaaaaaa
ttcgcctttgatatatatgacataaataaagatggaatgatttctaatggtgaattattt
accgttatgaaaatgatggttgggaataatttaaatgatgtacagttgcagcagctagtt
gatagaacaatcatacaagcagacaaagacggagatggaatgatttcatttgaagaattt
aaagatatgatatcgcacattgatgttgggaataaactcaagctagatttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system