KEGG   Plasmodium yoelii: PY01623Help
Entry
PY01623           CDS       T01035                                 

Definition
calcineurin b subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pyo  Plasmodium yoelii
Brite
Protein phosphatases and associated proteins [BR:pyo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PY01623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 166 aa AA seqDB search
MDIKKMYKRFLELDTNKNGQLDPNELFDVPEISDNMLRINLPCIKFYNPLVKRVISIFDS
NSDGKVSFVEFLVGITKLMSTTDDFQKKKFAFDIYDINKDGMISNGELFTVMKMMVGNNL
NDVQLQQLVDRTIIQADKDGDGMISFEEFKDMISHIDVGNKLKLDL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggatattaaaaaaatgtataaaagatttcttgaacttgatacaaataaaaacggacaa
ctagatccaaatgaattatttgatgttcctgaaataagcgataatatgttaagaattaat
ttaccatgtattaaattttacaatccactagtaaaaagagttatatcaatatttgattca
aattcagatggaaaagtatcatttgttgaatttttagttggaataacgaaattaatgtca
accacagacgattttcagaaaaaaaaattcgcctttgatatatatgacataaataaagat
ggaatgatttctaatggtgaattatttaccgttatgaaaatgatggttgggaataattta
aatgatgtacagttgcagcagctagttgatagaacaatcatacaagcagacaaagacgga
gatggaatgatttcatttgaagaatttaaagatatgatatcgcacattgatgttgggaat
aaactcaagctagatttataa

DBGET integrated database retrieval system