KEGG   Plasmodium yoelii: PY01695Help
Entry
PY01695           CDS       T01035                                 

Definition
acetyl-CoA carboxylase 1 precursor
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pyo  Plasmodium yoelii
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PY01695
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PY01695
   00640 Propanoate metabolism
    PY01695
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PY01695
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PY01695
Enzymes [BR:pyo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PY01695
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PY01695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2911 aa AA seqDB search
MISIFLSILLFVLIFENPTKSIKIRNTYYMHMYNNVNINNFAEKETRGQYPNRKGTNDVL
SENYRNKFMPLFVSKGTNILNSILKNKTFRYIYNDPERNTKKNSKNNSKNLAFLYTLHKH
SNTLSRISKSKSFQGDDIEKLENNNDEDNDSTNNISSRSNSNDIDKTYSFDHIGNNLNED
PEKKIFSFTSNRKDAQSGFRDDSNSSYITKDNLKKKSDSVNNREKKVLENLIDNFSNLNW
SNNIIDDANLNQPQYSKEFGSYIKSENDKSLHYYSDGILDHLYSYKKFSTKNKKKKNLNK
LFYSFKPLENVHTIKKGTITAQPIQNNAEIGTPLSHSDKNGISMSNINKRQIKFGDKRIY
MKKGDTCERDENEHIDDTEFLTYEETNNIKKKAYKDYINYINERRYPYINYLKMKNEKII
KKLLIANNGMAALKCILSLKEWLFKTFNDENLIQIIVLATEDDIKSNSKYISLSDKVIKV
PPGKNSYNYANVSLIVDIAKKENVDAVWPGWGHCSENPLLSSMLEKENIIFVGPTDNVME
ALGDKISANILAQSVNVPVVKWSGDNLKIKDFENNSISQDIYNKSTIHSLEECIRECKRI
GYPVMIKASQGGGGKGIRKVENENEIKKYYEQVQNELPNSPIFLMKVCSNVRHIEIQVVG
DMYGNVCSLSGRDCTTQRRFQKIFEEGPPSIVPPHTFREMEKASIRLTKMIKYRGAGTIE
YLYDQVNNKYYFLELNTRLQVEHPVSEGITDTNIVAIQLQVAMGIPLQNIDDIKKLYKIE
EKTKKNTSSSSVSIVNDKLKLPISEKDNNKTVKTNLSEQLGMFDFYNNMPHTKNHVIAAR
ITAENSNDSFKPTSGLVKNVNFQNSKDVWGYFSINNGFVHEFSDSQIGHIFAKGETREIA
RKNLILALRKLSIDGEIKTVTKYLAKILESKAFIDNNITTNWLDVVIERKKNIYYNAFHI
IILCAAIFKLLIYFMKEMENTEDSLNREDIAIKSENNINDISLNGKMKRAHIFDIIFQNV
KYKFKGYNTGEDLYKLNINDQEIEILAKYDKENNKIFASFHNQTYIYTCIEDSLGTHMNL
GKDNVFIPVITNPYHLISNTNGKIVKYLIKDGEKINKFDDYIEVEAMKMIMTFKSTETGI
LKHKMSEGAMIKIGDLLGVIEKEKDNQNYQNDDNNNKIIDFIGHLNLSNKNAYELNGTFV
PDLAEESHNNEVCCKNIEKEKMENLRKIEDPKNNKIYPTKHTNRNSQVNTTNESVSVQDI
KTENMKKDESQFCTEDKQIQNNQVNRRNKLFLKKNNGKNNKNNMFRLFSQKNDNDSKIID
SNIESNSRDDTLSYDKINKKNTNNESLKATKKEPKDATNMLETTKETSIGSKNYLNEKLN
SVKKYLTNLNLSITNTINKMSTTPNEELINDISENNLSTTNTMHNDSIVNSGSNDSLVSQ
RTNNISEEKIDNNKKLISYDNYKNQSYKDKIVSSEIDFPVNNTKDKKLDKMKIISDTEMS
RSNDDNSQSSRNRTNTNYNEKIELNFDNKKDKENEFFLELSNMKRIEYLLKGYXQDYEKC
FEDFLKDKNNFDKNLNYILDKFIEYNHLFSKKEIISEVEIYYILYKSISDKKKQYEIIHA
YTYNYLSIKLLEKILNNLINSKQTNLSLQILNKIKILKEFKGKIFGSIILLSRYIIYLYE
QNEKIHYLESSFQYNKNMEDMKKQSLQNYIRFLTKSSNMDNYKIDQILNNTNYEEKIKLF
LKSPSDIHYSLPFLFKTENVNYQEMFNTYLHNLYKYSTIKAKPHSPNCLVFSINNHEYNN
VMLNLNEDITIEQFKSMLDDILYEMKSDKINTFHIINKNETFFNSLQNYLDNAFKKVNTL
YIYNYFGNKYGEIHKINMNAYKEREKIQDNLEKSPIETNKNDSTINNKIYLLPFEEEILT
SENIASNFELKNVGQEVFNKTKILLGTYKQNNKYTSLFAQRIIDINDLQKQVDSDNIKVY
DEQENVGMTKNGKNNILLSKNIENGQMNNQIYDIFMSELKESIEDISIYRLNPSIRDIKI
SSNIIYHIVLPNNSNIEDQINGIKEIYKNFLNKYNELFIENYVNNVYIKVYKEIEEEKNN
ETKLELNQLLKLHVLFDNEKEVIEKVDKINPVIIDALYLKRKRARDVDTIYAYDFVKLIN
IALNRINNTLNDNFNYINSVKEFKIDYSRENSEEINDTVSVGKKEKSQPNKNDKQSKWLF
ENFDNLSSDEIRIKKSLYLSNSLEIGQNKMSVIGLLMNVKTDEYKEGRDIAFIINDITTN
GGAFSVLEDELFYGVSCYAREKKIPRICISCNSGAKIGLYNYLMDKIKVCWNDENKKELG
YKYIYITEEVKETIPKKDIIYLREIYENGEKRYIIDAIVGNLNNHIGVENLRGSGLIAGE
TSKAYDEIFTLSYVTGRSVGIGAYLVRLGKRTIQKKGSSLLLTGFNALNKILGEKVYISN
EQLGGVNIMMKNGISQLEAENDQDGVNKIFKWLSYVPKTSDNYFDVLGESTKSFHNKLQE
DNKCDITKSRNLNNSIDSDQQSNNYPNGYINDQDIQEYAKKNSLHSSSDSTTVEPESIKE
CDTSLIHINGNNGDEESGNEISDTISDNWNKINDVDMDNVNEADIIELLKGSDKKQGFLD
KNSYFEYMNEWGKGIITGRGKLGSIPIGFIAVNKNLVTQTVPCDPALKTKAIKTTNAPCV
FVPDNSYKTAQSIEDFNKENLPLFVFANWRGFSGGTMDMFNSILKFGSMIVNQLVNYKHP
VFVYIPILGELRGGSWVVVDETLNSQIIEMYADTNSKGGILEPPGLVEVKFKFAEIKKLM
NNSDPYIIELNQKLATLQNEEEILSVKKEIEKKEKEMLPFYLQVCHKYADLHDVSSCMKE
KGVIRKIVPWEKSRSFFYYRLLRRLILHTLK
NT seq 8736 nt NT seq  +upstreamnt  +downstreamnt
atgattagtatctttttatcaatattactatttgttctcatatttgaaaatccaacaaaa
tctataaaaattagaaacacttattatatgcacatgtataataatgttaatatcaataat
tttgcagaaaaagaaacgagaggccaatatccaaatagaaaagggacaaatgatgtttta
tctgaaaattatcgaaataagtttatgcctttatttgtgtctaaaggaacaaatatatta
aattccattttaaaaaataaaacgtttagatatatatataatgatccagaaagaaataca
aaaaaaaattcaaagaataattctaagaatttggcatttctttacacccttcataaacat
tcgaatacattaagtagaatttcaaaaagcaagagcttccagggagatgatatagaaaaa
ttggaaaataataatgatgaagataacgacagcacaaacaatataagtagtagaagtaat
agcaatgatattgataaaacgtattcatttgaccatataggaaataatttaaatgaagat
cccgagaaaaaaattttcagctttacatcaaatagaaaagatgctcaaagtggctttagg
gatgattccaattccagctacataactaaggacaatttaaagaaaaaaagcgatagtgta
aataatagagaaaaaaaagttttagaaaatttgatagacaatttttcaaatttaaactgg
tctaataatataattgatgatgcaaatttaaatcaaccacaatattcaaaagaatttggc
tcttatataaaatcggaaaacgataaatcattacactactattcagatggtatactagac
catctttattcgtataaaaaatttagtacaaaaaataagaaaaaaaaaaatttgaataaa
ttattttacagctttaagccattggaaaatgttcatacgataaaaaaaggaactataact
gcgcagcctattcaaaataatgcggaaatagggacacctttatcccacagtgacaaaaat
ggaatatctatgagcaatataaacaaaagacaaataaaattcggagataaacgaatatac
atgaaaaaaggggatacttgtgaaagagatgaaaatgaacatattgatgataccgaattt
ttaacatacgaagaaacaaataatataaaaaaaaaagcatataaagattatattaattat
ataaatgaaagacgatatccatatataaattatttaaaaatgaaaaatgaaaaaataata
aaaaaattattaattgctaataatggtatggctgcattaaaatgtatattgtcattaaaa
gaatggttatttaaaacatttaatgatgaaaatttgatacaaataatagtgttagctact
gaagatgatataaaaagtaattccaaatacatatctttatcagataaagttattaaagtt
ccaccgggaaaaaacagttataattatgcaaatgtttctttaattgttgacattgcaaaa
aaagaaaatgttgatgcagtttggccaggttggggacattgctcagaaaatccattattg
tcatctatgctagaaaaggaaaatataatttttgttggaccgactgataatgttatggaa
gcattaggtgataaaatatcagccaacattttagctcaaagtgttaatgtacctgttgtt
aaatggagtggcgataatttaaaaattaaagattttgaaaataattcaattagtcaagat
atatataataaatctactattcattcgttagaagaatgtatcagagaatgcaaaaggatt
ggctatcctgttatgataaaagcgtcacaaggtggtggtggtaaaggtattcgaaaggta
gaaaacgaaaatgaaataaaaaaatattatgaacaagttcaaaatgaattaccaaattca
ccaatatttttaatgaaagtatgtagcaatgttagacatattgaaatacaagttgttggt
gatatgtatggaaatgtttgttcattaagtggtagagattgtactacacaaagacgattt
caaaaaatatttgaagagggaccaccttctattgttcctccacatacttttagagaaatg
gaaaaagcatctatacgtttaacaaaaatgatcaaatatagaggtgcaggaaccattgaa
tatttatatgatcaagttaataacaaatattattttttagaattaaatacccgtttacaa
gtagagcatcctgtttcagaaggaataacagataccaatattgtcgctattcaacttcaa
gttgctatgggcatacctcttcaaaatatagatgatataaaaaaattatataaaatagaa
gagaaaacaaaaaaaaacacatcgtcaagcagtgttagtattgtaaatgataagttaaaa
cttccaataagcgaaaaagataataataaaacagtgaaaactaatttgagtgaacaactt
ggcatgtttgatttttacaacaacatgccccacactaaaaatcatgttattgctgctcga
ataacagccgaaaacagtaatgatagttttaaaccaacgtcaggcttagtaaaaaatgtt
aattttcaaaattcgaaagatgtatggggttatttctctatcaataatgggtttgttcat
gaattttcagattcacaaattggccatatatttgcaaaaggggaaacaagagaaattgct
agaaaaaatttaattctagcgttaaggaaattaagcatagatggagaaattaagacagtt
acaaaatatttagcaaaaatattagaatctaaagcatttatagataacaatataacaaca
aattggttagatgttgtaatagaacgaaaaaaaaacatttattataatgcttttcatata
attattttgtgtgctgccatatttaaactgttgatttattttatgaaagaaatggaaaat
acggaagatagcctaaatagggaagacattgctataaaatcagaaaataatatcaatgac
ataagtttaaatggaaaaatgaaaagagcacacatttttgatataatttttcaaaatgta
aaatataagtttaaaggatataatactggtgaagatttatacaaattgaatataaatgat
caagaaatagaaatattagcaaaatatgataaagaaaataataaaatatttgcatcattc
cataatcaaacatatatatatacatgtatagaagattccttaggaacacatatgaattta
gggaaagataatgtatttattcctgttattactaatccatatcatttaatatcaaataca
aatggaaaaattgtaaaatatttaataaaagatggtgaaaaaattaacaaatttgatgat
tacatagaagtagaagcgatgaaaatgattatgacttttaaatctactgaaactggtata
ttaaagcataagatgtcagaaggtgctatgataaaaattggtgatttattaggagttata
gaaaaggaaaaggataatcaaaattaccaaaatgatgataataataacaaaattattgat
tttattgggcatctaaatttgtcaaacaaaaatgcatatgaattaaacggaacatttgtt
ccagacttagcagaagagtcacataataacgaagtatgctgtaaaaacattgaaaaagaa
aaaatggaaaacctcagaaaaattgaagatccgaaaaataataaaatttatcccacaaaa
cacaccaatagaaattcacaggttaatacaacaaatgaatcagtgtctgttcaagatata
aaaacggaaaatatgaaaaaagatgaaagccaattttgcacagaagataaacaaatacaa
aataaccaagtaaatagacggaataaattgtttttgaaaaaaaataatggaaaaaataac
aaaaataatatgtttcgtttattttcccagaaaaatgataatgacagtaaaataatagat
tcgaatatagaaagtaactccagagatgatactttaagttatgataagataaataaaaaa
aatactaacaatgaatcattaaaagccaccaaaaaagaaccaaaagatgctacaaatatg
ctcgaaacaactaaagaaacgtctataggatcaaaaaattatttaaatgaaaaattaaat
tctgttaaaaaatatttaacgaatttaaatttatcgataacaaataccataaataaaatg
agtacaacacctaatgaagaattaataaatgatatttctgaaaataatttatctactaca
aatacaatgcataatgattcaatcgttaattctggtagcaatgattcacttgttagtcaa
agaacgaataatatatcagaagaaaagatagataataataaaaaattgatatcttatgac
aattataagaatcaatcatataaagacaaaatagtttctagtgaaattgattttccggta
aataataccaaagataaaaaattggataaaatgaaaataattagtgacaccgaaatgagc
agaagcaatgatgacaattcacaaagtagtagaaatagaaccaatacaaattacaatgaa
aagattgaattaaattttgataacaagaaagataaagaaaatgaatttttccttgaatta
tcaaacatgaaaagaattgaatatttattaaaaggatatgamcaagactatgaaaaatgc
tttgaagatttcttaaaagacaaaaataattttgataaaaatctaaattatatattagat
aaatttatagaatataatcatttattttctaaaaaggaaattattagcgaagtagaaatt
tattatattttatataaaagcattagtgataagaaaaaacaatatgaaattatacatgca
tatacatacaactatttaagtataaaacttctagaaaaaatattaaacaatttaataaat
agtaaacaaactaatttgtctttgcaaattttaaataaaataaaaatattaaaagaattc
aaaggaaagatttttggatctataattttgctatcaagatacattatatacttatatgaa
cagaatgaaaaaattcattatttagaatcttcttttcaatataataaaaatatggaagat
atgaagaagcaaagtttacaaaattatatccgttttcttactaagtcgagcaatatggat
aattataaaatagatcaaatcttaaataatacaaattatgaagaaaagataaaattattt
ttaaaatcaccatctgatatccattattctttaccatttttatttaaaactgaaaatgtt
aattatcaagaaatgttcaatacatatttacataatttatacaaatattctactataaaa
gctaagccacattcacctaattgtttagtattttctataaataatcatgaatataacaac
gtcatgttaaatttaaatgaagacatcactattgaacaatttaaaagtatgctggatgat
atattatatgaaatgaaatctgacaagataaatacattccatataataaataaaaatgaa
accttctttaattcactgcaaaactatttagataatgctttcaaaaaagttaatacttta
tatatatataactattttggaaataaatatggagaaattcataaaattaatatgaacgca
tataaagaacgagaaaaaatacaagacaacctcgaaaaaagtccaatagaaactaataaa
aatgattctactataaataataaaatatatctccttccttttgaagaagaaattcttact
tcagagaatattgcatcaaattttgaattaaaaaatgtaggacaggaagtatttaataag
actaaaatattactaggaacatacaaacaaaacaataaatacacttcgttatttgctcaa
agaataattgatataaatgatttacaaaaacaagttgattcagacaatataaaggtatat
gatgaacaagagaatgttggaatgaccaaaaatggaaaaaataatatactattgtcaaaa
aatatagaaaatggtcaaatgaacaatcaaatttatgatatatttatgtctgaattaaaa
gaatctatagaagatataagcatttatagattaaacccatcaattcgggatattaaaatt
agtagcaatataatatatcatatagtattacctaataactcaaatatagaagatcaaata
aatggaattaaagaaatttataaaaatttcctcaataaatataatgaacttttcatagaa
aactatgttaataatgtatatattaaagtatataaagaaattgaagaagaaaaaaataat
gaaacaaaattagagcttaaccaattgttgaaattgcatgttctttttgataatgaaaaa
gaggttattgaaaaagtggataaaataaatccagttattatcgatgcattgtacttaaaa
cgaaagagagcaagggatgtagatactatatatgcttatgattttgttaagcttataaac
atagcattaaataggataaataatactttgaatgataattttaattatattaatagtgtg
aaagaattcaagatagattatagtagggaaaactccgaagaaataaatgatacagtaagt
gtgggaaagaaagaaaaatctcaacctaacaaaaatgataaacaatctaaatggcttttt
gaaaattttgacaatttaagtagtgatgaaattcgaataaaaaaatcactttatttatca
aactctttggaaataggacaaaataaaatgagcgtaatcggattgttaatgaatgtaaag
acagatgaatataaagaaggaagagatattgcttttataataaatgatattacaacaaat
ggaggtgcatttagtgttttagaagacgaactattttatggagtatcatgttatgcgaga
gaaaaaaaaataccacgtatatgtatatcttgcaattccggagcaaaaattggattatat
aattatcttatggataaaattaaagtatgctggaatgatgaaaacaaaaaagaacttgga
tataaatatatatatataacagaagaagtaaaagaaacaattcctaaaaaagatattatt
tatttaagagaaatttatgaaaatggagaaaaaagatatataattgatgctatagtagga
aatttaaataatcatataggagtagaaaatttaagaggtagtggattaatagcaggagaa
acctcaaaggcttatgatgagatttttactctttcatatgtcactggaagaagtgttgga
attggtgcttatttagttagattaggtaaacgaactattcaaaaaaaaggatcgtctctt
ttactaactggttttaatgctttaaataaaatattaggtgaaaaggtatatataagtaat
gaacaattaggaggtgtaaatattatgatgaaaaatggaatatctcaattagaagctgaa
aatgaccaggatggagtaaataaaattttcaaatggttatcatatgttcctaaaactagt
gacaattattttgatgttcttggggaatcaacaaaatcatttcacaataaattacaagaa
gataacaaatgtgatattaccaaatctagaaacttaaacaattcaattgattctgaccaa
caatccaataattatccaaatggatacattaatgatcaagacatacaagagtatgcaaaa
aagaacagtttgcacagcagttcagatagtactactgttgaaccagaaagtatcaaagaa
tgtgatacttcacttatacacatcaatggaaataatggtgatgaagaatcagggaacgaa
attagtgatacgatttcagataactggaacaaaataaatgatgtagatatggacaatgta
aatgaagcagatattatcgaattactaaaagggtcagataaaaaacaaggatttttagac
aaaaatagttactttgaatatatgaatgaatggggaaaaggtattataactggaagagga
aaattaggatcaataccaattggttttattgctgtaaataaaaatttagttacccaaact
gttccatgtgatccagcattgaaaactaaggctataaaaacaacaaatgccccatgtgtt
tttgtgcctgataattcgtacaaaactgcccaatctattgaagattttaataaagaaaat
ttacctttatttgtctttgcaaattggagaggtttttcaggaggtactatggatatgttt
aacagtatcttaaaatttggatcaatgatagttaatcaattagttaattataagcatccc
gtttttgtatacatacctattttgggagaacttagaggtgggtcttgggtagtagtagat
gaaacattgaacagccaaataatagaaatgtatgcagatactaatagtaaaggtggaata
ttagaacctccaggattagtagaagtcaaatttaagttcgcagaaattaagaaattaatg
aataacagtgatccatatataatagaactaaatcagaaactcgcgactcttcagaatgaa
gaagaaattttaagtgtaaaaaaggaaatagaaaagaaggaaaaggaaatgcttccattt
tatttacaagtgtgtcataaatatgcagatctacatgatgtatcatcatgtatgaaggag
aaaggtgttattagaaaaattgttccatgggaaaaatctagatcctttttctattatcgc
ttattaaggagattgatattacatacattaaagtaa

DBGET integrated database retrieval system