KEGG   Plasmodium yoelii: PY17X_1327900Help
Entry
PY17X_1327900     CDS       T01035                                 

Gene name
PY01755
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase isozyme L3, putative
  KO
K05609  ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PY17X_1327900 (PY01755)
Peptidases [BR:pyo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PY17X_1327900 (PY01755)
Ubiquitin system [BR:pyo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    PY17X_1327900 (PY01755)
  UBL-specific proteases (ULPs)
   PY17X_1327900 (PY01755)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12 NPL4
Motif
Other DBs
NCBI-GeneID: 3806855
NCBI-ProteinID: XP_022813581
Position
13
AA seq 228 aa AA seqDB search
MTKKKIWIPIESNPDSLYLYSCKLGQQKLSFVDIYGFSKDLLDMIPKPVHAIIFLYPIKD
DIDNNIGSSHINTTNDDSNIWFIKQTVSNSCGTIALLHLLANLRNTFPLDKDSVLDTFFN
KVDHLKPEGRAMEFENSDIIEQLHHEFSGNELNSGESIDVDTHFIVFLEINGMLVELDGR
KNHPIIHGQTTSTNFVYDAGKLIQDNFISKYQDCHSFSALAIVPNDTV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaaaaaatatggataccaatagaatcgaatcccgattcgttgtatttgtac
tcttgtaaacttggacaacaaaagttaagttttgtagacatttatggttttagcaaggat
ttattagatatgatacctaaacctgttcacgcaataatattcttatatccaataaaggat
gatatagataataacattggttcaagtcacataaatacaacaaatgacgatagcaacatt
tggttcataaagcaaaccgtctcaaattcttgtggtactatagcacttttgcatttgctt
gcaaatttgaggaatacatttccattagataaagattccgtattggacacattttttaat
aaagttgaccacctaaaaccggaaggccgcgcaatggaatttgagaatagcgatattatt
gaacaactacaccatgagttttctggaaatgaattaaattcaggagaaagcattgatgtt
gacacacattttattgtgttcttagaaataaatggaatgctagtcgaattggatggaaga
aaaaatcaccccataattcatggccaaaccacgagcaccaattttgtatatgatgctgga
aaattaatccaagataactttataagcaaatatcaagattgccacagcttttctgccctt
gcaattgtaccaaacgacacagtgtaa

DBGET integrated database retrieval system