KEGG   Plasmodium yoelii: PY01755Help
Entry
PY01755           CDS       T01035                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PY01755
Peptidases [BR:pyo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PY01755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 160 aa AA seqDB search
MLNDNNIGSSHINTTNDDSNIWFIKQTVSNSCGTIALLHLLANLRNTFPLDKDSVLDTFF
NKVDHLKPEGRAMVDTHFIVFLEINGMLVELDGRKNHPIIHGQTTSTNFVYDAGKLIQDN
FISKYQDCHSFSALAIVPNDTVNIVEGADGVIFKIGKYIQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgataataacattggttcaagtcacataaatacaacaaatgacgatagcaac
atttggttcataaagcaaaccgtctcaaattcttgtggtactatagcacttttgcatttg
cttgcaaatttgaggaatacatttccattagataaagattccgtattggacacatttttt
aataaagttgaccacctaaaaccggaaggccgcgcaatggttgacacacattttattgtg
ttcttagaaataaatggaatgctagtcgaattggatggaagaaaaaatcaccccataatt
catggccaaaccacgagcaccaattttgtatatgatgctggaaaattaatccaagataac
tttataagcaaatatcaagattgccacagcttttctgcccttgcaattgtaccaaacgac
acagtaaacattgtagaaggagcagatggtgtgatttttaaaattggcaaatatattcaa
taa

DBGET integrated database retrieval system