KEGG   Plasmodium yoelii: PY01854Help
Entry
PY01854           CDS       T01035                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
pyo  Plasmodium yoelii
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pyo04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2004 aa AA seqDB search
MSSNSPISVSLVDNLASYNIQNESFRLGNVSIEGDKFICVKENVNDNTQVVVINLYNQVS
IRKYMKADSVIIHPNDPILALRGSIKNANTIFLQVFNIETKEKICSLNLNEHINYWKWIN
NDTIAIVCEKNVYHWNIDMYNTKKNKENNVLTKVFEKAQIFIDNNSQILYYGTDKEMKWC
ILCGISTQDQGKSIDGHMQLYSCEKKLHQIIEGFIGCFGSFIFENWDTKPLFCFIEKKKN
SSMSRLHLMDIYNSKTEGSTPYKIVKEINLINDTLNDFPIYISLNTLQGVIYVITKCSYV
YIFDESTLTEIVREKISDDNIFICCDNKNGEGIIAVNKKGKIYYITLNYISLINSLKSSN
IDVKDKIIRNLSLKYGYPGCDYISVYKKCISEMDFKKASKIICLLKNPKIFEKYSNSISE
AITIMNKKNMDIRIVSPLRTQQVLNSFKTFRNSQGQLSPLLLYFSVLLELDKLNTYESIE
LVKPVVLQKKKEYLEKWIKDDKLACSEELGDLVKSLDLRLSLIIYLRCGAHNKIISIYCL
LNMFNNVMTYINNYKHITNFDFVNIFITIINYEFPTTSGGGSFNSGNTNGNDSGSSLDLH
HTEKNESLDFFNDNNSVSNSKDLKNGNNHRNTNIEIATQYIKLLSDNNIQLDIGKIVDYL
LNNNKLQEATSILLDYLKDNKPEHKHLQTKIFEFNLHHNVQIAETIFQMDIFTYYDKNRI
AYLCEEKGLYQRALENYTNINDIKRVITKSACFQKNGNISNNLNSEGGSGNMSLHGGISL
EWIKNYFSTLSDSVCQDLLFDFMKGNKVNIEIIISICVQYYNKIGIKKIVNKFEENKNYE
GIFYFISSILNELQNMGTVGNANDIGKYNDNNSISSNNNINNNLSSSRSNNDDTSSILIN
SDIGIGTQFPYENNSVLTIEDLHHIMFKYIEACVKINNIQELDRICKDRNAKYNPEQIKN
FLKECKLSDPRPLIYVCDIHNFIEELAEYLYKNSLLKYIEVYVIKVNPHNAHKVIGVLLD
LDASEDFLLNLLNNIKNISNIGNLIDIAEKRNRLKLLLPWLESRSNEGYENIELHNALAK
IYIDLNKDPETFLKNNNFYDKKMIGKYCEDLDPHLAYTAYERSNGQCDEELINITSKNGL
FKLQAKYLVSRQSMGLWSMVLDESNKYRKNVIDQVIGSTLIESNNADEITVTVKAFIEKK
LSSELIELLEKIVLHNSEFRDNKNLQNLLILTAIKSDSKKVMEYINRLDNFSGPQIAEVA
YEYKLREEAFVIYKKFNCNTSAISVLLDNILTFNKNRKGKMSANARRKKIELALFNTIIN
DYSGNDSDGYLNVTNFSGALSSSYNEKPDGASSIYGSNEVFRNYGSGQLSEFEDENNEEQ
EMEKDETHPNIENYEEDLNRAIEFAQKCNVNDVWFILGKAQLKLNKIIDAIDSFIKSNNA
GAYKEVIEKCKENNFYEQLITYLNTLREQNSLKDVLVDSELLYAYAKLKKTLEMTKFIAS
TNLANMQLIGDRLYKEKEYDAAKILYSSIPNNQKLTFCHLKLKEYSLAIEAAKKTKSLKT
WREVNLVCVKYKQLKFAHIAGLQLIMHADHLDEIIKIYEKKKYINELLSLLENGLNSERA
HVGIYTELGMLYAKYKPEKLMEFIRSYTNKMNTRKLIDVCHNEYLLKEAVYLYISYDEYN
LAVDTIIKHSPIAYQPDIFMQVIHKVTNSDIIHKVIDFYIEENPLNLYNLLKILENKIDN
NRLVQTMKKSNNLPLIQKYLEDIQTQNITSVNETLNEIYLENDDYISLRKSIDEYDNFNQ
TNLINKLENHKLAEMRRIAALLYKKNKKFKEAINLSKKEGQIKDAIDIARVSKNHLYVED
LINYFIQIKNKEALCACLIACYDILKPDYVLEIIWLSGFKDHAMLYFIQIISDYTQQIET
MKKQIEDIEKEKKMNKSAPNDYSANTISNQFTYSLNKNLSIMPPQNNYIPNNSDFDKYDI
SYMTTCEFYFLCFFYFPYLFALRK
NT seq 6015 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaaatagccccatatcggttagtcttgttgataaccttgcttcatataatatt
cagaatgaatcttttcgtctaggaaatgtgtcaatcgaaggagacaagtttatttgcgta
aaagaaaatgtaaatgacaacacgcaagtcgtagtgataaatttatataaccaagttagt
attcgtaagtatatgaaagctgatagtgttattatacaccctaatgatccaatattagca
ttaagaggtagcataaaaaatgcgaatacgatatttttacaagtatttaatatagaaaca
aaagaaaaaatatgttcattaaatttaaatgagcatataaattattggaaatggataaat
aatgatacgattgcaattgtttgtgaaaaaaatgtatatcactggaatatagatatgtat
aatacaaaaaaaaataaagaaaataatgtacttacaaaagtttttgaaaaagcacaaata
tttattgataataattcacaaatattatattatggtacagataaagaaatgaaatggtgt
atattgtgtggtatatctacacaagatcagggaaagagcattgatgggcatatgcaatta
tattcatgtgaaaaaaaattgcatcaaataattgaaggatttattggatgttttggttca
tttatatttgagaattgggatacaaaaccattattttgttttattgaaaaaaaaaaaaat
tcaagtatgtcgaggttacatttaatggatatatataatagtaaaacagaaggaagtaca
ccttataaaattgtaaaagaaataaacttaataaatgacacattaaatgatttccctata
tatataagtttaaatacattacaaggtgttatatatgttattacaaaatgcagttatgta
tatatatttgatgaaagtactttaactgaaatagtaagggaaaaaataagtgatgataat
atatttatatgttgtgataacaaaaatggtgaaggaataattgcagtaaataaaaaagga
aaaatatattatataacattaaattatattagtttaataaattcattaaaatcatctaat
atagatgtaaaggataaaataattagaaacttatcattaaaatatggatatccaggttgt
gattatatatctgtatataaaaaatgtattagtgaaatggattttaaaaaagcatcaaaa
attatatgtttactaaaaaatccaaaaatatttgaaaaatattctaattctatatctgaa
gcaataacaataatgaataaaaaaaatatggatataagaattgtatcacctttacgaact
caacaagttttaaatagttttaaaacatttcgaaattctcaaggtcaactatctccatta
cttttatatttttcagtattattagaacttgataaattaaatacatatgaatctattgaa
ttagttaagccagttgttttacaaaaaaaaaaagaatatttagaaaaatggataaaagat
gataaattagcatgctcagaagaattgggagatttagtaaaatccttagatttacgatta
tcattaatcatatatttaagatgtggagcacataataaaataatttctatatattgtttg
ttaaatatgtttaataatgttatgacatatattaataattataagcatattacaaatttc
gattttgttaatatatttattacaataattaactatgaatttcctacgacatcaggaggg
ggaagttttaattcagggaatactaatggtaatgattcgggttctagtttagatttgcat
catacagaaaaaaatgaatccttggattttttcaatgataataatagtgtttctaattcg
aaggatttaaaaaatggtaacaatcatagaaacactaatattgagattgcaactcagtat
ataaaattgttaagtgataataatatccaattagatattggaaaaatagttgactattta
ttaaataataacaaattacaggaagctacatctatattgttagattacttaaaagataat
aaaccagaacataaacatttgcaaaccaaaatattcgaatttaatttacatcataatgtt
caaattgctgaaacgatttttcaaatggatatatttacttactatgataaaaataggata
gcatatttatgtgaagaaaaaggattatatcaaagagctttagaaaattatactaatatt
aatgatattaaaagagttattacaaaatcagcatgttttcaaaaaaatggaaatatttca
aataatttaaattcagaaggtgggtcaggtaatatgagcttacatggtggaatatctctt
gaatggattaaaaattatttttcaacattaagtgattcagtttgtcaagatttgttattt
gattttatgaaaggaaataaagtaaatattgaaattataatttcgatatgtgttcaatat
tataataaaattggaattaaaaaaattgtgaataaatttgaagagaataaaaattatgag
ggaatattttattttattagttctatattgaatgagttacaaaatatgggcactgttgga
aatgctaatgatataggaaaatataatgataataacagtattagtagtaataacaatatt
aataataatttatcaagctctagaagtaacaacgatgatacgtcatctattttaataaat
tcagacattggaattggcacacaatttccctacgaaaataattctgttttaactattgaa
gatttgcatcatataatgtttaaatatatcgaagcatgtgtaaaaattaacaatattcaa
gaattagatagaatatgtaaagacagaaatgcaaaatataaccctgaacaaataaaaaac
tttttaaaagaatgcaaattatcagaccctcgcccattaatatatgtatgtgatatacat
aattttatagaagaattagctgaatatttatataaaaatagtttgttaaaatatattgaa
gtatatgttattaaggtgaacccacataatgctcataaagttattggagttttattagat
ttagatgcatcagaagattttcttcttaatttattaaataatataaaaaatatatcaaac
attggtaatttaatagatatagcagaaaaacgaaatcgattaaaattattgttaccatgg
cttgaaagtagatctaatgaaggttatgaaaatattgaattacataatgctttagcaaaa
atttatattgatttaaataaagatcctgaaacatttttaaaaaataacaatttttatgat
aaaaaaatgataggaaaatattgtgaagatttagacccacatttagcatatactgcatat
gaaagatcaaatggtcaatgtgatgaagaacttataaatataacaagtaaaaatggtctt
tttaaattacaagctaaatatttagtatctaggcaatcgatgggattatggtcaatggta
ttagatgaatcaaataaatatcgaaaaaatgtaatcgaccaagttataggttcaacttta
attgaatcgaataatgctgatgaaattactgtaactgttaaagcatttattgaaaaaaaa
ttaagtagtgaattaattgaattgctagaaaaaattgtattacataatagtgaatttagg
gataataaaaatttgcaaaatttgttaattttaacagctatcaaatcagattcaaaaaaa
gttatggaatatattaacaggcttgacaatttttcaggtccacaaatagcagaagttgca
tatgaatacaaattaagagaagaagcttttgtcatatataaaaaatttaattgcaacaca
tctgctatttcagttttattggataatatcctgacttttaataaaaaccgaaaaggtaag
atgtcagcaaatgctcgaagaaaaaaaatcgagcttgctttatttaatacaataattaat
gattactctggaaatgattctgatggttatttaaatgttacgaatttttcaggggcgtta
agtagctcatataatgaaaaaccagatggagcatcatctatctatggaagtaatgaagta
ttccggaattatggaagtggacaattatctgaatttgaagacgaaaataatgaggaacaa
gaaatggaaaaagacgaaacacatcctaatatagaaaactatgaagaagatttaaataga
gctattgaatttgcacaaaaatgtaatgtaaatgatgtatggtttatattaggtaaggct
caattaaaattgaataaaattatcgatgcaattgatagctttattaaatcaaataatgca
ggtgcttataaagaggttatagaaaaatgtaaagaaaacaatttttatgaacagttaata
acttatttaaatacattaagagaacaaaattcattaaaagatgtcttagtagattctgaa
ttattatatgcatatgccaaattaaaaaaaacattagaaatgacaaaatttatagctagc
acaaatttagcaaatatgcaattaattggtgatagattatataaagaaaaagaatatgat
gcagcaaagatattatatagcagtatcccgaataatcaaaaactgacattttgtcattta
aaattaaaagaatattcattagctattgaagctgctaaaaaaacaaaaagtcttaaaacg
tggagagaagtaaatttagtatgtgtaaaatataaacaattaaaatttgcacatatagca
ggattacaactcattatgcatgcagatcatttagatgaaatcataaaaatttatgaaaaa
aaaaaatatataaatgaactattgagtttattggaaaacgggttaaatagtgaaagagct
catgtaggaatatatacagaattaggaatgttatatgcaaaatataaaccagaaaaatta
atggagtttataagaagttatactaataaaatgaatacaaggaaattaatagatgtatgt
cataatgaatatttattaaaagaagcagtatatttatatatatcatatgatgaatataac
ttagctgttgatacaattattaaacactctcctattgcttatcagcctgatatatttatg
caagtaatacataaagtaacaaatagtgatataatacacaaagtaatagatttttatatt
gaagaaaatccattgaatttatataatttattaaagattttagaaaataaaattgataat
aatagattagtacaaacaatgaaaaaatcaaataatttaccattaatacagaaatattta
gaagatattcaaacacaaaatattacatctgttaatgaaaccctaaatgaaatttatcta
gaaaatgatgattatattagtttaagaaaatcgatagacgaatatgataattttaatcaa
acaaatttaattaataaattggaaaatcacaaattagctgaaatgagaagaattgcagca
ttattatataaaaaaaataaaaaatttaaagaagctattaatttatcaaaaaaagaagga
caaattaaagatgctattgatattgctagagtttctaaaaatcatctatatgttgaggat
ctaattaattattttattcaaattaaaaataaggaagctttgtgtgcttgtttaattgct
tgttatgatatattgaaaccagattatgttttagaaattatatggttgagtggatttaaa
gatcatgctatgttatatttcatacaaattattagtgattatactcaacaaatcgaaacc
atgaaaaaacaaatagaagatatagaaaaggaaaaaaaaatgaataaatcagctcctaat
gattattctgccaatactatttcaaatcaattcacatattcgttgaataaaaacttatcc
attatgcctccacaaaataattatattccaaataattcagactttgacaaatatgacata
agttatatgactacgtgtgaattttattttttatgctttttttattttccctatttattt
gcacttcgtaaatga

DBGET integrated database retrieval system