KEGG   Plasmodium yoelii: PY17X_1014800Help
Entry
PY17X_1014800     CDS       T01035                                 

Gene name
PY02176
Definition
(RefSeq) mitogen-activated protein kinase 1, putative
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PY17X_1014800 (PY02176)
Protein kinases [BR:pyo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   PY17X_1014800 (PY02176)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH Imm7
Motif
Other DBs
NCBI-GeneID: 3807344
NCBI-ProteinID: XP_730041
UniProt: A0A078KC76
Position
10
AA seq 570 aa AA seqDB search
MEREKQKKAQKNVSKLFHTKSNKNETDNIDEHVLKKYDIIKKIGKGAYGIVFKARCRKYK
KIVAVKKIFGAFQNSTDAQRTFREIMFLHQLNGHDNIIKLLDVMRAKNDQDIYLVFEYME
TDLHEVIRADILEEVHKKYIIYQLLRALKYMHSGLLLHRDIKPSNILLNSECHLKICDFG
LARSISTEVNENKIPVLTDYVATRWYRAPDILLGSTNYTEGVDMWSLGCIMAELLLGKPL
FRGNSTMNQLEKIIEIVGKPNKKDIEDIKSPYAETIISSFADTGKKKKKFSEIFHKASQD
SIDLLEKLLQFNPTKRITAENALKHKYVENFHLLIEEPICKHIITIPVNESTKYKVDFYR
NIIYYNILKRKKNLIHREDYTNVQINNDVKTDVPIDGEKENNYDIHQMDSTKKRGKKKRH
FISNSPNANLETYQKYETNCRENNSQYLVEKKTDMNTTQGNKEKGSNAKKKLKNKIKPKQ
KTLTIKNSEKKNTLNYYDKSEILHDKNEKYYYEHTGENNNNNNANEQNDYYKNIANQDIE
SQYRNTMAVHNYNPGQDFSKHYFYKQKKKY
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggagagagaaaaacagaagaaagctcaaaaaaatgtgtctaaactatttcataccaaa
tcgaataaaaatgaaacagataatattgatgagcatgttttaaaaaaatatgatataata
aaaaaaattggaaaaggagcatatggtatagtattcaaagctcggtgtagaaaatataaa
aaaatagtagccgtaaaaaaaatctttggagcatttcaaaattctacagatgctcaaaga
acatttcgagaaattatgttcttacatcaattaaatggtcatgataatataattaaacta
ttagatgtaatgagagctaaaaatgatcaagacatttatttagtatttgaatatatggaa
acagatttacatgaagttataagagcagatatattagaagaagttcataaaaaatatata
atatatcaattattaagagcactgaaatatatgcattcaggtttattattacatagagat
attaagccatcaaatatattactaaattcagaatgtcatttaaagatatgtgattttgga
ttagctcgaagtatatcaacagaagtcaatgaaaataaaataccagtgttaacagattat
gtagcaacacgttggtatagagcccctgatattttattaggaagtacaaattatacagaa
ggtgtcgatatgtggtcgcttgggtgcattatggctgaattattattaggaaaaccatta
tttagaggtaattcaactatgaatcaactagaaaaaattattgaaatagttggaaaacca
aataaaaaagatattgaagatataaaatcaccatatgctgaaactattatatcttctttt
gctgatactggaaaaaaaaaaaaaaaattttcagaaatatttcataaagcatctcaagat
tctatagatctacttgaaaaattgttacaatttaatccaacaaaaagaataacagcagaa
aatgctcttaaacataaatatgtagaaaactttcatcttttaatagaggaaccaatttgt
aaacatattattacgataccagttaatgagagcacaaaatataaagttgatttttatcga
aatattatatattacaatattttaaaaaggaaaaaaaatttgattcacagagaggattat
acaaatgttcaaattaataatgatgtaaagacagatgtgccaatagatggtgaaaaagaa
aataattatgatattcatcaaatggattcaacaaaaaaacgaggaaaaaaaaaacgacat
tttatatctaactcaccaaatgcaaatctagagacgtatcaaaaatatgaaacaaattgt
agagaaaataattcacaatatcttgtggaaaaaaaaacagatatgaatacaactcaaggg
aataaagaaaaaggaagtaatgcaaaaaaaaaattaaaaaataaaattaaaccaaaacaa
aaaacattaaccataaaaaattctgaaaaaaaaaatacactaaattattatgataaatcg
gaaattttacacgacaaaaatgaaaagtattattatgaacatacaggtgaaaataataat
aataataatgcaaatgaacaaaatgactattacaaaaatatagctaatcaagatattgag
tctcagtatcgaaatacaatggctgtgcataattataaccctggtcaagattttagtaag
cattatttttataaacaaaagaaaaaatactga

DBGET integrated database retrieval system