KEGG   Plasmodium yoelii: PY02176Help
Entry
PY02176           CDS       T01035                                 

Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PY02176
Protein kinases [BR:pyo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PY02176
Exosome [BR:pyo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PY02176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 570 aa AA seqDB search
MEREKQKKAQKNVSKLFHTKSNKNETDNIDEHVLKKYDIIKKIGKGAYGIVFKARCRKYK
KIVAVKKIFGAFQNSTDAQRTFREIMFLHQLNGHDNIIKLLDVMRAKNDQDIYLVFEYME
TDLHEVIRADILEEVHKKYIIYQLLRALKYMHSGLLLHRDIKPSNILLNSECHLKICDFG
LARSISTEVNENKIPVLTDYVATRWYRAPDILLGSTNYTEGVDMWSLGCIMAELLLGKPL
FRGNSTMNQLEKIIEIVGKPNKKDIEDIKSPYAETIISSFADTGKKKKKFSEIFHKASQD
SIDLLEKLLQFNPTKRITAENALKHKYVENFHLLIEEPICKHIITIPVNESTKYKVDFYR
NIIYYNILKRKKNLIHREDYTNVQINNDVKTDVPIDGEKENNYDIHQMDSTKKRGKKKRH
FISNSPNANLETYQKYETNCRENNSQYLVEKKTDMNTTQGNKEKGSNAKKKLKNKIKPKQ
KTLTIKNSEKKNTLNYYDKSEILHDKNEKYYYEHTGENNNNNNANEQNDYYKNIANQDIE
SQYRNTMAVHNYNPGQDFSKHYFYKQKKKY
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggagagagaaaaacagaagaaagctcaaaaaaatgtgtctaaactatttcataccaaa
tcgaataaaaatgaaacagataatattgatgagcatgttttaaaaaaatatgatataata
aaaaaaattggaaaaggagcatatggtatagtattcaaagctcggtgtagaaaatataaa
aaaatagtagccgtaaaaaaaatctttggagcatttcaaaattctacagatgctcaaaga
acatttcgagaaattatgttcttacatcaattaaatggtcatgataatataattaaacta
ttagatgtaatgagagctaaaaatgatcaagacatttatttagtatttgaatatatggaa
acagatttacatgaagttataagagcagatatattagaagaagttcataaaaaatatata
atatatcaattattaagagcactgaaatatatgcattcaggtttattattacatagagat
attaagccatcaaatatattactaaattcagaatgtcatttaaagatatgtgattttgga
ttagctcgaagtatatcaacagaagtcaatgaaaataaaataccagtgttaacagattat
gtagcaacacgttggtatagagcccctgatattttattaggaagtacaaattatacagaa
ggtgtcgatatgtggtcgcttgggtgcattatggctgaattattattaggaaaaccatta
tttagaggtaattcaactatgaatcaactagaaaaaattattgaaatagttggaaaacca
aataaaaaagatattgaagatataaaatcaccatatgctgaaactattatatcttctttt
gctgatactggaaaaaaaaaaaaaaaattttcagaaatatttcataaagcatctcaagat
tctatagatctacttgaaaaattgttacaatttaatccaacaaaaagaataacagcagaa
aatgctcttaaacataaatatgtagaaaactttcatcttttaatagaggaaccaatttgt
aaacatattattacgataccagttaatgagagcacaaaatataaagttgatttttatcga
aatattatatattacaatattttaaaaaggaaaaaaaatttgattcacagagaggattat
acaaatgttcaaattaataatgatgtaaagacagatgtgccaatagatggtgaaaaagaa
aataattatgatattcatcaaatggattcaacaaaaaaacgaggaaaaaaaaaacgacat
tttatatctaactcaccaaatgcaaatctagagacgtatcaaaaatatgaaacaaattgt
agagaaaataattcacaatatcttgtggaaaaaaaaacagatatgaatacaactcaaggg
aataaagaaaaaggaagtaatgcaaaaaaaaaattaaaaaataaaattaaaccaaaacaa
aaaacattaaccataaaaaattctgaaaaaaaaaatacactaaattattatgataaatcg
gaaattttacacgacaaaaatgaaaagtattattatgaacatacaggtgaaaataataat
aataataatgcaaatgaacaaaatgactattacaaaaatatagctaatcaagatattgag
tctcagtatcgaaatacaatggctgtgcataattataaccctggtcaagattttagtaag
cattatttttataaacaaaagaaaaaatactga

DBGET integrated database retrieval system