KEGG   Plasmodium yoelii: PY02220Help
Entry
PY02220           CDS       T01035                                 

Definition
3-hydroxyisobutyryl-Coenzyme A hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pyo  Plasmodium yoelii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PY02220
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PY02220
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PY02220
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PY02220
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PY02220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MINGLLNMVKSLSNDDRCNLIVIRSINQNCFCSGSDVKDIVQNKDQGINHLKQLYKYINF
ISKINKNILCIWNGYAMGGGLGISMYTKYRIINKNVIFAMPENKIGFFPDVGSSYFLKKY
FPRNIALHLGLTSLRLNEIDLINFKVCTNYIENLDQFLNELYNIKKEDPNKFNEELIKIL
NKYPPKVNVNTKPVLTEELISNIDKYYTSANNLEELINNLKKNEDNDNFCKQLLLDINAN
CYFSCQLWFSYFIYNYDKPMEEVLDNDFKMTQYFLYHTNTFEKGVTEILIKKNKSFQWSK
DHENNPVKLEETIEDILMNKNLLSIKDEFI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgattaatggattattaaatatggtaaaaagtttaagcaatgatgatagatgtaatttg
atagtaataagaagtatcaatcaaaattgtttttgttcgggttcagatgtaaaagatata
gttcagaataaagatcaagggataaatcatttaaaacaactatataagtatattaatttt
atttcaaaaattaataaaaatatcttatgcatatggaatgggtatgctatgggtggggga
ttaggtatatctatgtatacaaagtatcgaatcataaataaaaatgtaatatttgccatg
ccagaaaataaaataggttttttccctgatgttggaagctcttattttttaaaaaaatat
tttccacgaaatattgctttacacttaggattaacatcattgcgattaaatgaaattgat
ttaattaattttaaagtatgtactaattatatagaaaacctagaccaatttttgaatgaa
ttgtataatattaaaaaagaagacccaaataaatttaatgaggaacttattaaaatttta
aataaataccccccaaaagttaatgttaatacaaaaccagtattaacagaagaattaatt
agtaatatcgacaagtattatacatctgccaataatttagaggaattgataaataattta
aaaaaaaatgaagataatgataatttttgtaaacaattattattagatataaacgctaat
tgttattttagctgccaattatggttctcttattttatatataactatgacaaacctatg
gaagaagtattagataacgattttaagatgactcagtattttttatatcacactaacaca
tttgaaaagggggtaactgaaatattaataaaaaaaaataaaagctttcaatggagtaag
gaccatgaaaataaccctgtgaaattggaagaaactattgaagatattttgatgaataaa
aatttattgtctattaaagatgaatttatataa

DBGET integrated database retrieval system