KEGG   Plasmodium yoelii: PY17X_1428800Help
Entry
PY17X_1428800     CDS       T01035                                 

Gene name
PY02226
Definition
(RefSeq) dihydropteroate synthetase, putative
Organism
pyo  Plasmodium yoelii
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_bind HPPK
Motif
Other DBs
NCBI-GeneID: 3807399
NCBI-ProteinID: XP_022812911
Position
14
AA seq 680 aa AA seqDB search
MDIIEESNKCKENNKGNIIVLNFGTTDKTNAVTILETALYLTEKYIGKIINTSYMYETVP
EYVVLDKSDIPKNIRGEDEPYDVSSLNDLVKGLEKSKYENVFQDEENLVSQCEEYERFLN
NKDLFENKVKQISAENYETETSNIIKENDEIMKINLEKHKNKYYTSYFYNLVAVFKCFID
DPLNLLVILKYIEYLMKRKNSKEVEKFENRLIDIDILFFNNYTIFEKNINLTTNDLYAIM
CKYINIEYDNNSSDNCNKWSIAIEQIKDNIKFLSIPHVYTKHRYSILLCLNDVIPNYKHN
VLKETINKLYEEFITSFSKLYNTCIKKYNKRLYVLKNEVLYLKEKTNIVGILNTNYNSFS
DGGLFVKPNIAVHRMFQMINEGVDIIDIGGESSAPFVSHNPEIKERDLVIPVLELFEQEW
NKMLQIRENGMEKQKDKLNKNDLSLQKKTSTIYKPPISIDTMNYDLFKECVEKNLVDILN
DISACTNDPKIIKLLKKKNKYYSVVLMHKRGNPHTMDMLTQYDDVVYDIKKYLEDRLNFL
TLNGIPRYRIILDIGLGFAKKHDQSIKLLQNIQVYDDYPLFIGYSRKRFISHTLEQTCAE
ICPNTIAENENIQNDESGKNTFTVRNIRKDKDQYLYQKNILGGLAIASYCFDKKVEMIRV
HDVFETRCVLDMMKKLHQTE
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggatattatagaagagtctaataaatgtaaggaaaataacaaagggaatattattgtt
ttaaattttggaacaactgacaaaacaaatgcggtaacaattttagaaacagcattatat
cttactgagaagtatataggaaaaataataaatacttcgtatatgtacgaaactgtcccg
gagtatgttgtactcgacaaaagtgatataccgaaaaatataagaggagaagatgagcct
tatgatgtaagtagtttaaacgatttggtaaagggtcttgaaaagtcgaaatatgagaat
gtttttcaagatgaagaaaatttagtttcacagtgtgaagaatatgaaagatttttaaat
aataaagatttatttgaaaataaagtaaaacagattagtgctgaaaattatgaaactgaa
actagtaatataataaaggaaaatgatgaaataatgaaaattaatttagaaaaacataaa
aataaatactacacgagttatttttataatttagttgcagtttttaaatgtttcattgat
gatccattaaacttattagtaatattaaaatatatagaatacctaatgaaaagaaaaaat
tctaaggaggttgaaaaatttgaaaaccgattgatagacatagatatattattttttaat
aattatactatttttgaaaaaaatataaatttaacaacaaatgatttatatgcaattatg
tgtaaatatatcaatatagaatatgacaataatagtagtgataattgtaataaatggtca
atagctattgagcaaataaaggataatataaaatttctttctattcctcatgtatataca
aaacatagatatagtatattgttatgtttaaatgatgttataccaaattataagcataat
gttttaaaagaaacaataaataaattatatgaagaatttattactagcttttcaaaatta
tataatacatgtatcaaaaaatataacaagcgattatatgttctaaaaaatgaagtattg
tatttaaaagaaaaaacaaatatagttggcatattaaataccaattataattctttttcg
gatggtggcttatttgttaaaccgaatattgctgtacacagaatgtttcaaatgataaat
gaaggtgtagatattatagacataggtggtgaatcctctgctccttttgtttctcataat
ccagaaattaaagaacgtgatttggtaattcctgtactagaattatttgaacaagagtgg
aataaaatgttacaaattcgtgaaaatggaatggagaaacagaaggataaattgaataaa
aatgacctatctttacaaaaaaaaacatcaactatttataaaccgcctataagtatagat
accatgaactatgatttattcaaagaatgtgttgaaaaaaatttagttgatatacttaat
gatataagtgcatgtacaaatgatccaaaaataattaaattattaaagaagaaaaataaa
tattatagtgttgttttaatgcataaaagaggaaatccacatactatggatatgttaaca
caatatgatgatgttgtatatgatattaaaaagtatttagaggatagattaaatttttta
actttaaatggtatacctagatatagaattatattagatataggtttaggttttgcaaag
aagcatgatcaatccattaaattattacaaaacattcaggtttacgatgattatcctctt
tttattggatattcaaggaagagatttatatctcatactttggaacaaacttgcgctgaa
atatgtcctaatactattgctgaaaatgaaaatattcaaaatgatgaatctggtaaaaac
acgtttacagttaggaatataagaaaggacaaagatcagtatctttatcaaaaaaatata
ctaggtggattagccattgcatcatattgctttgataaaaaagttgaaatgataagagtt
catgatgtttttgaaactagatgtgttttagatatgatgaaaaaattgcaccaaacggaa
taa

DBGET integrated database retrieval system