KEGG   Plasmodium yoelii: PY02226Help
Entry
PY02226           CDS       T01035                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pyo  Plasmodium yoelii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pyo00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 688 aa AA seqDB search
MSISLISYFPMGKCIYGCKYYMFSIFSYFYYFYKFTGKIINTSYMYETVPEYVVLDKSDI
PKNIRGEDEPYDVSSLNDLVKGLEKSKYENVFQDEENLVSQCEEYERFLNNKDLFENKVK
QISAENYETETSNIIKENDEIMKINLEKHKNKYYTSYFYNLVAVFKCFIDDPLNLLVILK
YIEYLMKRKNSKEVEKFENRLIDIDILFFNNYTIFEKNINLTTNDLYAIMCKYINIEYDN
NSSDNCNKWSIAIEQIKDNIKFLSIPHVYTKHRYSILLCLNDVIPNYKHNVLKETINKLY
EEFITSFSKLYNTCIKKYNKRLYVLKNEVLYLKEKTNIVGILNTNYNSFSDGGLFVKPNI
AVHRMFQMINEGVDIIDIGGESSAPFVSHNPEIKERDLVIPVLELFEQEWNKMLQIRENG
MEKQKDKLNKNDLSLQKKTSTIYKPPISIDTMNYDLFKECVEKNLVDILNDISACTNDPK
IIKLLKKKNKYYSVVLMHKRGNPHTMDMLTQYDDVVYDIKKYLEDRLNFLTLNGIPRYRI
ILDIGLGFAKKHDQSIKLLQNIQVYDDYPLFIGYSRKRFISHTLEQTCAEICPNTIAENE
NIQNDESGKNTFTVRNIRKDKDQYLYQKNILGTFIMFCAFSYAHLISTICGLAIASYCFD
KKVEMIRVHDVFETRCVLDMMKKLHQTE
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgagcataagcttaataagttattttcctatggggaaatgcatatatggatgtaaatat
tatatgttttccatcttttcttatttttattatttttataaatttacaggaaaaataata
aatacttcgtatatgtacgaaactgtcccggagtatgttgtactcgacaaaagtgatata
ccgaaaaatataagaggagaagatgagccttatgatgtaagtagtttaaacgatttggta
aagggtcttgaaaagtcgaaatatgagaatgtttttcaagatgaagaaaatttagtttca
cagtgtgaagaatatgaaagatttttaaataataaagatttatttgaaaataaagtaaaa
cagattagtgctgaaaattatgaaactgaaactagtaatataataaaggaaaatgatgaa
ataatgaaaattaatttagaaaaacataaaaataaatactacacgagttatttttataat
ttagttgcagtttttaaatgtttcattgatgatccattaaacttattagtaatattaaaa
tatatagaatacctaatgaaaagaaaaaattctaaggaggttgaaaaatttgaaaaccga
ttgatagacatagatatattattttttaataattatactatttttgaaaaaaatataaat
ttaacaacaaatgatttatatgcaattatgtgtaaatatatcaatatagaatatgacaat
aatagtagtgataattgtaataaatggtcaatagctattgagcaaataaaggataatata
aaatttctttctattcctcatgtatatacaaaacatagatatagtatattgttatgttta
aatgatgttataccaaattataagcataatgttttaaaagaaacaataaataaattatat
gaagaatttattactagcttttcaaaattatataatacatgtatcaaaaaatataacaag
cgattatatgttctaaaaaatgaagtattgtatttaaaagaaaaaacaaatatagttggc
atattaaataccaattataattctttttcggatggtggcttatttgttaaaccgaatatt
gctgtacacagaatgtttcaaatgataaatgaaggtgtagatattatagacataggtggt
gaatcctctgctccttttgtttctcataatccagaaattaaagaacgtgatttggtaatt
cctgtactagaattatttgaacaagagtggaataaaatgttacaaattcgtgaaaatgga
atggagaaacagaaggataaattgaataaaaatgacctatctttacaaaaaaaaacatca
actatttataaaccgcctataagtatagataccatgaactatgatttattcaaagaatgt
gttgaaaaaaatttagttgatatacttaatgatataagtgcatgtacaaatgatccaaaa
ataattaaattattaaagaagaaaaataaatattatagtgttgttttaatgcataaaaga
ggaaatccacatactatggatatgttaacacaatatgatgatgttgtatatgatattaaa
aagtatttagaggatagattaaattttttaactttaaatggtatacctagatatagaatt
atattagatataggtttaggttttgcaaagaagcatgatcaatccattaaattattacaa
aacattcaggtttacgatgattatcctctttttattggatattcaaggaagagatttata
tctcatactttggaacaaacttgcgctgaaatatgtcctaatactattgctgaaaatgaa
aatattcaaaatgatgaatctggtaaaaacacgtttacagttaggaatataagaaaggac
aaagatcagtatctttatcaaaaaaatatactaggtacttttattatgttctgtgctttt
tcgtatgcacatttgatttcaaccatatgtggattagccattgcatcatattgctttgat
aaaaaagttgaaatgataagagttcatgatgtttttgaaactagatgtgttttagatatg
atgaaaaaattgcaccaaacggaataa

DBGET integrated database retrieval system