KEGG   Plasmodium yoelii: PY17X_1009800Help
Entry
PY17X_1009800     CDS       T01035                                 

Gene name
PY02304
Definition
(RefSeq) cGMP-dependent protein kinase, putative
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     PY17X_1009800 (PY02304)
Protein kinases [BR:pyo01001]
 Serine/threonine kinases: AGC group
  PKG family
   PY17X_1009800 (PY02304)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Pkinase Pkinase_Tyr Kinase-like APH Kdo
Motif
Other DBs
NCBI-GeneID: 3807486
NCBI-ProteinID: XP_022813267
Position
10
AA seq 853 aa AA seqDB search
MDDDEIIPKKNNERNKKKAILSHEDFTGEDSLMENHLELRDKLAEDIVTIKTSLKNNLVC
STLNENEILALSNYMQFFVFKSGDMVIKQGEKGSYFFIINSGKFDVYVNDKKVKTLTKGS
SFGEAALIHNTQRSATIKAGTNGTLWGVQRSTFRATLKQLSNRNFNENRSFIDSVSVFDM
LTEAQKNMITNACVIQNFKPGETIVKQGDYGDVLYILKDGKATVYINDEEIRVLEKGSYF
GERALLYDEPRSATIIAKEVTSCASICRKLLNVVLGNLQVVLFRNIMTEALQQSEIFKQI
SPDQLNDLADTAIVRDYPANYNILHKDKIKSVKYIIVLEGKVELFLDDESIGILTRGKSF
GDQYVLNQKQKFKHTLKSLEVCKIALITESCLADCLGNNNIDASIDYNNKKSIIKKMYIF
RYLTDKQCNLLIEAFKTTRYEEGDYIIQEGEVGSRFYIIKTGEVEIVKNNKRLRTLGKND
YFGERALIYDEPRTASVISTVNNLECWYVDKSVFLQIIEGPMLAHLEERIKMQDTKVEMS
ELLTERIIGRGTFGIVKLVLHEPTKIRYALKCVSKKSIIELNQQNNIKLEREITAENDHP
FIIRLVRTFKDSKYFYFLTELVTGGELYDAIRKLGLLSRSQAQFYLGSIILAIEYLHERS
IVYRDLKPENILLDKQGYVKLIDFGCAKKIHGRSYTLVGTPHYMAPEVILGKGYGCTVDI
WAFGVCLYEFICGPLPFGNDQEDQLEIFRDILTGQLTFPDYVTDTDSINLIKRLLCRLPQ
GRIGCSINGFKDIKENPFFADFDWDRLAGRLLEPPLISKSETYAEDIDVKQIEQEEEDNA
NTEIDDENWDIDF
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatgaaataattccaaagaaaaacaatgaaagaaataaaaaaaaagcaatt
ttatctcatgaggatttcacaggggaggatagtttaatggagaaccacctagaattgagg
gataaattagcagaagatatcgtcactataaaaacatccctaaaaaataatcttgtatgt
agtacactaaatgaaaatgaaatattagcactgtctaattatatgcagttttttgttttc
aaaagtggggatatggtcataaaacaaggagaaaaaggttcctacttcttcattataaat
agcggaaaatttgatgtatacgtaaatgacaaaaaagtgaaaactttgaccaaaggtagc
tcatttggggaagctgccttaatacataatactcaaagaagtgctactataaaagcagga
acaaatggaacgctatggggtgtgcaaagaagtacattcagagcgacactaaaacaatta
tccaatagaaattttaatgaaaatagaagctttattgattctgtatctgtttttgatatg
ctaacagaagcacaaaaaaatatgataaccaatgcatgcgttatacaaaattttaaaccc
ggagaaacaatagttaaacaaggggattatggagatgttctatatattctaaaagacgga
aaagcaaccgtatatattaatgatgaagaaatcagagttctagaaaagggatcttacttc
ggagaaagagctcttttgtatgatgaaccacgaagtgctacaattatcgctaaggaagta
acatcttgtgcatctatttgtcgaaaattgctaaatgtggttctgggaaatttacaagta
gtattgtttcgtaacattatgacagaagctcttcaacagagcgaaatatttaaacaaata
agtccagatcaattaaatgatttagcggatacagctatagttagagattacccagcaaat
tataatatattacataaagataagataaaaagtgtaaaatatataatagtattagaaggt
aaagtagagttattccttgatgatgaatcaattggaatattgacgagaggtaaatcattt
ggagatcaatatgtacttaatcaaaaacaaaaatttaagcatacattaaaatcgttagag
gtatgcaaaatagcattaattacagaatcgtgcttagccgattgcttaggaaataataat
atagacgcatctatagattataataataaaaaaagtatcataaaaaaaatgtatattttc
cgatatttaactgataaacagtgtaatttacttatcgaagcatttaaaacaactcgatat
gaagaaggagattatattatacaagaaggtgaagtagggtcaagattttatataataaaa
actggagaagtagaaatagtaaaaaataataaaagattaagaacattaggaaaaaatgat
tattttggtgaaagagcattaatttatgatgaaccaagaacagcatcagttataagcact
gtaaataatttagaatgttggtatgttgataaatcagtttttttacaaattattgaagga
cccatgttagcacatttggaagaaagaattaaaatgcaagatactaaagtagagatgtca
gaattattaacagaaagaataatagggagaggtacatttggtattgtcaaactagtttta
catgaacccacaaaaattagatatgcattaaaatgcgttagtaaaaaaagtattatagaa
ttaaatcaacaaaataatatcaaattagaaagagaaattactgctgaaaatgaccatcca
tttattattaggttagtaagaaccttcaaagattctaaatatttttattttttaacggag
ttggttactggaggagaactttatgatgctattagaaagttaggtttattatcaagatca
caagcacagttttatttaggctctattatattagcaattgaatatttacatgaaagaagt
atagtatatcgagatttaaaacctgaaaacatcttattagataagcaagggtatgttaaa
ttaatcgattttggttgtgcaaaaaaaatacatggaagatcatatacattagttggaaca
ccacattatatggcccctgaagttatattaggaaaggggtatgggtgcacggttgatata
tgggcattcggtgtttgtttatatgaatttatatgtggtccattaccctttggtaatgat
caagaagatcaattagaaatatttagagacatattaacagggcagttaaccttcccagat
tatgttactgatactgatagtattaatttaattaaaagattattatgcagattaccccaa
ggaagaatcggatgctcaataaatggattcaaagatattaaagaaaatccattttttgca
gattttgattgggacagattagctggacgtttgcttgaacctcctctcatttcgaaaagc
gaaacttatgcagaggatatcgatgttaaacagatcgaacaagaagaggaagataatgca
aataccgaaattgatgatgaaaattgggatattgatttttaa

DBGET integrated database retrieval system