KEGG   Plasmodium yoelii: PY02304Help
Entry
PY02304           CDS       T01035                                 

Definition
cGMP-dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pyo  Plasmodium yoelii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 782 aa AA seqDB search
MISSCEGSYFFIINSGKFDVYVNDKKVKTLTKGSSFGEAALIHNTQRSATIKAGTNGTLW
GVQRSTFRATLKQLSNRNFNENRSFIDSVSVFDMLTEAQKNMITNACVIQNFKPGETIVK
QGDYGDVLYILKDGKATVYINDEEIRVLEKNLTFPNNTISIVSFQGSYFGERALLYDEPR
SATIIAKEVTSCASICRKLLNVVLGNLQVVLFRNIMTEALQQSEIFKQISPDQLNDLADT
AIVRDYPANYNILHKDKIKSVKYIIVLEGKVELFLDDESIGILTRGKSFGDQYVLNQKQK
FKHTLKSLEVCKIALITESCLADCLGNNNIDASIDYNNKKSIIKKMYIFRYLTDKQCNLL
IEAFKTTRYEEGDYIIQEGEVGSRFYIIKTGEVEIVKNNKRLRTLGKNDYFGERALIYDE
PRTASVISTVNNLECWYVDKSVFLQIIEGPMLAHLEERIKMQDTKVEMSELLTERIIGRG
TFGIVKLVLHEPTKIRYALKCVSKKSIIELNQQNNIKLEREITAENDHPFIIRLVRTFKD
SKYFYFLTELVTGGELYDAIRKLGLLSRSQAQFYLGSIILAIEYLHERSIVYRDLKPENI
LLDKQGYVKLIDFGCAKKIHGRSYTLVGTPHYMAPEVILGKGYGCTVDIWAFGVCLYEFI
CGPLPFGNDQEDQLEIFRDILTGQLTFPDYVTDTDSINLIKRLLCRLPQGRIGCSINGFK
DIKENPFFADFDWDRLAGRLLEPPLISKSETYAEDIDVKQIEQEEEDNANTEIDDENWDI
DF
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgatttcctcttgcgaaggttcctacttcttcattataaatagcggaaaatttgatgta
tacgtaaatgacaaaaaagtgaaaactttgaccaaaggtagctcatttggggaagctgcc
ttaatacataatactcaaagaagtgctactataaaagcaggaacaaatggaacgctatgg
ggtgtgcaaagaagtacattcagagcgacactaaaacaattatccaatagaaattttaat
gaaaatagaagctttattgattctgtatctgtttttgatatgctaacagaagcacaaaaa
aatatgataaccaatgcatgcgttatacaaaattttaaacccggagaaacaatagttaaa
caaggggattatggagatgttctatatattctaaaagacggaaaagcaaccgtatatatt
aatgatgaagaaatcagagttctagaaaagaatttaacatttcctaataatacaatctcg
attgtttcttttcagggatcttacttcggagaaagagctcttttgtatgatgaaccacga
agtgctacaattatcgctaaggaagtaacatcttgtgcatctatttgtcgaaaattgcta
aatgtggttctgggaaatttacaagtagtattgtttcgtaacattatgacagaagctctt
caacagagcgaaatatttaaacaaataagtccagatcaattaaatgatttagcggataca
gctatagttagagattacccagcaaattataatatattacataaagataagataaaaagt
gtaaaatatataatagtattagaaggtaaagtagagttattccttgatgatgaatcaatt
ggaatattgacgagaggtaaatcatttggagatcaatatgtacttaatcaaaaacaaaaa
tttaagcatacattaaaatcgttagaggtatgcaaaatagcattaattacagaatcgtgc
ttagccgattgcttaggaaataataatatagacgcatctatagattataataataaaaaa
agtatcataaaaaaaatgtatattttccgatatttaactgataaacagtgtaatttactt
atcgaagcatttaaaacaactcgatatgaagaaggagattatattatacaagaaggtgaa
gtagggtcaagattttatataataaaaactggagaagtagaaatagtaaaaaataataaa
agattaagaacattaggaaaaaatgattattttggtgaaagagcattaatttatgatgaa
ccaagaacagcatcagttataagcactgtaaataatttagaatgttggtatgttgataaa
tcagtttttttacaaattattgaaggacccatgttagcacatttggaagaaagaattaaa
atgcaagatactaaagtagagatgtcagaattattaacagaaagaataatagggagaggt
acatttggtattgtcaaactagttttacatgaacccacaaaaattagatatgcattaaaa
tgcgttagtaaaaaaagtattatagaattaaatcaacaaaataatatcaaattagaaaga
gaaattactgctgaaaatgaccatccatttattattaggttagtaagaaccttcaaagat
tctaaatatttttattttttaacggagttggttactggaggagaactttatgatgctatt
agaaagttaggtttattatcaagatcacaagcacagttttatttaggctctattatatta
gcaattgaatatttacatgaaagaagtatagtatatcgagatttaaaacctgaaaacatc
ttattagataagcaagggtatgttaaattaatcgattttggttgtgcaaaaaaaatacat
ggaagatcatatacattagttggaacaccacattatatggcccctgaagttatattagga
aaggggtatgggtgcacggttgatatatgggcattcggtgtttgtttatatgaatttata
tgtggtccattaccctttggtaatgatcaagaagatcaattagaaatatttagagacata
ttaacagggcagttaaccttcccagattatgttactgatactgatagtattaatttaatt
aaaagattattatgcagattaccccaaggaagaatcggatgctcaataaatggattcaaa
gatattaaagaaaatccattttttgcagattttgattgggacagattagctggacgtttg
cttgaacctcctctcatttcgaaaagcgaaacttatgcagaggatatcgatgttaaacag
atcgaacaagaagaggaagataatgcaaataccgaaattgatgatgaaaattgggatatt
gatttttaa

DBGET integrated database retrieval system