KEGG   Plasmodium yoelii: PY02443Help
Entry
PY02443           CDS       T01035                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PY02443
Peptidases [BR:pyo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PY02443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 370 aa AA seqDB search
MNISYHNFIDTFNIKNYEYYEKYYNYEDSKRNHTAFINNGNICYCNASLQLILSIKPLCI
YILKNFDKFYLKTQSKYKGDIIKTMYELIHETYNIGETKNNNILCTNKHINLLKKINKYN
LHLDIFSQNDAHEFMLLLLNYINIECNRYTDNEKNMEIILDENDDKELAGDKYWVKYLYK
ENSIITDLLGFQNISTITCFNCDHTRYSFEFCLDLGLEFPDENIKSTTLIELLKNNINKS
DDICSLDCNNCKLKKTSRIKKGIYRMPNLYMIIYIKRFKWVYYQSNNCYNNKVKKIDTIV
LLPQDGIVDFTNFLQLSNHNSLYNAKYIIESIICHSGNSYNGHYTSISHAMKYLITTHNK
NYHFNISLYI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatcatatcacaactttatcgatacatttaacataaaaaactacgagtattat
gaaaagtattacaactatgaagattccaaaagaaatcacacagcatttataaataatgga
aatatatgttattgcaatgcttcactacaactaatattgtcaattaaacctctttgcata
tatatactaaaaaatttcgacaaattttacctcaagactcaatctaaatataaaggagat
ataattaaaacaatgtatgaattgattcacgaaacttataatattggagaaacaaagaac
aacaatatattatgtacaaataaacacataaatttacttaaaaaaattaacaaatataat
ttacatttggatattttttcacaaaatgatgctcatgaatttatgctattattactaaat
tatattaatatagaatgtaatagatatacagataatgaaaaaaatatggaaataatattg
gacgaaaacgatgacaaagaattggcaggagataaatattgggtaaaatatctatataaa
gaaaatagtataataactgatttactaggctttcaaaatatttctactattacctgtttt
aattgtgatcatacacgatacagttttgaattctgcttagatttgggattagaatttcct
gatgaaaatataaaaagtactacacttatagaattacttaaaaacaatataaataaaagt
gacgatatttgttcattagattgtaataattgtaaactaaaaaaaacaagtcgaataaaa
aaagggatatatagaatgcctaatttatatatgataatatatataaaaagatttaaatgg
gtatattaccaaagtaataactgttataataacaaagttaaaaaaatagatacaattgta
ttactaccccaagatggtatcgtcgattttacaaattttttacaactctctaatcataat
tctttatataacgccaaatatattattgaaagtattatatgccatagtggaaatagttat
aatggccattacacatctataagtcacgcaatgaaatatttaataacaactcacaataag
aactatcatttcaatatatctctatatatataa

DBGET integrated database retrieval system