KEGG   Plasmodium yoelii: PY02616Help
Entry
PY02616           CDS       T01035                                 

Definition
histone H2B variant 1
Orthology
K11252  
histone H2B
Organism
pyo  Plasmodium yoelii
Brite
Exosome [BR:pyo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PY02616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 123 aa AA seqDB search
MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQVHPETGVTKKSMNIMN
SFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaggaccagcacaaaaatcacaagctgcaaagaaaacagcaggaaaaacc
ttgggcccaaggcacaaaagaaaaagaagaacagaatctttttcactttacatttttaaa
gttttaaaacaagtccatccagaaacaggagtaacgaaaaaaagcatgaacattatgaat
tcatttatcaatgatatttttgacagattagttactgaagcaactagattaattcgttac
aataaaaaaagaactttgtcatcacgtgaaattcaaactgcagttagattacttttacct
ggtgaattatcaaaacacgctgtttcagaaggtaccaaagctgtaacaaaatatactacc
agtggtgcataa

DBGET integrated database retrieval system