KEGG   Plasmodium yoelii: PY17X_1422300Help
Entry
PY17X_1422300     CDS       T01035                                 

Gene name
PY02616
Definition
(RefSeq) histone H2B variant, putative
  KO
K11252  histone H2B
Organism
pyo  Plasmodium yoelii
Brite
Chromosome [BR:pyo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    PY17X_1422300 (PY02616)
Exosome [BR:pyo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PY17X_1422300 (PY02616)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone TFIID_20kDa CBFD_NFYB_HMF RP-C Asr YscO-like
Motif
Other DBs
NCBI-GeneID: 3829747
NCBI-ProteinID: XP_730523
UniProt: A0A077YCV5
Position
14
AA seq 123 aa AA seqDB search
MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQVHPETGVTKKSMNIMN
SFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaggaccagcacaaaaatcacaagctgcaaagaaaacagcaggaaaaacc
ttgggcccaaggcacaaaagaaaaagaagaacagaatctttttcactttacatttttaaa
gttttaaaacaagtccatccagaaacaggagtaacgaaaaaaagcatgaacattatgaat
tcatttatcaatgatatttttgacagattagttactgaagcaactagattaattcgttac
aataaaaaaagaactttgtcatcacgtgaaattcaaactgcagttagattacttttacct
ggtgaattatcaaaacacgctgtttcagaaggtaccaaagctgtaacaaaatatactacc
agtggtgcataa

DBGET integrated database retrieval system