KEGG   Plasmodium yoelii: PY02679Help
Entry
PY02679           CDS       T01035                                 

Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PY02679
Transcription machinery [BR:pyo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PY02679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1402 aa AA seqDB search
MECIVTNENSRXPPYHNFLKNENIYNYIDYIQIIGNIYYKYTEINDIINQIYIKRIGLLN
SVKNVKRNNPNFENLQINSKTKHVYPISIYKQDTLSITSINSDSINSDSTNSDSTNSDST
NSDSTNNWENVKSNINCQVIKNKNNHNESYNQNFDKTYGDISLERNTFLTTINKKYLKQN
TQPLLNYSDEIRMCSSGENGNAGNAENGGNVGNSGNAGNAGNAGNSGNAENAGNAGNAGD
AGNDGNDGDDGNAWKDKKKCGNDEDENLINEKLINENLRNENNDEVDNLSKQIYDDKIKN
KIEVNIKHDNIIGNNNVTNKTNVSNNTIGNIDGNNIKYDVFQGDDKMVIGGNYVNNNMNN
PFNVNKNLIMGSKNFNLTASGKTYRGNKINESGKTTNGIMVKENEEEYRHDHLNNNNNNN
IPISNDGKKDFTKLDGIDINNIGNNPNVYNQIMASHINRMNNNNNVIIMKNFNPINFPIN
SHNFNMIPPYNNVGNVGNVGNVGNVGNMGGMGGMGGMGSIINNNIPNIPNIPNIPNIPNI
QNIPNISSISNIQNIQNIPNIQNIQNIQNIPNNFLMNTQINGINNNSLNDINITNPSSGV
IGVLGNLSYNNNVISNNIDGNLNKKNSSAFIDKDKSIKDNENCKKNNIKNSNNKNINNVE
GENNKNTIKNIRMENLKFNDNIDLKNIDGIDLSSYFVNGKYCSKLPNHEKIYNIIYYIVN
NSLHEYLTDFYNSEDLVYKEKDEKEENEQNEEDENVLKNETTKCGEANILDSDKNSKGEQ
NILLENSEQIIEKEENXKNKRNADDIIDENEIDKEDGNDDNTIRKKKKIKVENGNENGNE
NENGNGNGNGNENENQNQNQNQNKNQNGNGGVDAPCKNNQIVDEDGNKKSGNINNAENCM
SNNNNMKPEMKDNENNYILGEITKSICSILNLQQLMPVNTRLNNSGLIYDPNYETIYSKW
KLFLKKEQSSGNIISKCFSRDFLHTVLLCNYDSIIEDLKKTAVKKKIKYFFLHICLEANL
PINVALMLFLNATKQSDKLQSLLPSETGLGYLHRDAGGAKEENMGIITFECITNDREPDH
LIKLITLKNIFSRQLPKMPREYIVRLVFDRNHYTFCLLKKNTVIGGVCFRPYFEQKFAEI
AFLAVTSTEQVKGYGTRLMNHLKEHVKKFGIEYFLTYADNFAIGYFRKQGFSQKISMPKE
RWFGYIKDYDGGTLMECYIFPNINYLRLSEMLYEQKKTVKKAIHFIKPQIIFKGLNYFTE
NKGGNLHPNNIPGLLEIGWKKEYKDMTTKKTHHKEVQLKDQIINVLDYLEKQQSAWPFLK
PVSLSEAPDYYDIIKEPTDILTMRRKARHGEYKTKEDFGIELKRMFDNCRLYNAPTTIYF
KYANELQALIWPKYEEISEMAK
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtattgtgaccaatgaaaatagtaggttwcctccttatcacaattttttaaaa
aatgaaaatatatacaactatatagattatattcaaattattggaaatatttattataaa
tataccgaaataaatgatattattaatcagatatacataaaaagaataggtctgttaaat
agtgtcaaaaatgtgaaaagaaataatccaaactttgaaaatcttcaaataaattcgaaa
acgaaacatgtgtatccaatatctatatataaacaagacaccttatctattacatctata
aatagtgattctataaatagtgattctacaaatagtgattcgacaaatagtgattctaca
aatagtgattctacaaataattgggaaaatgttaaatctaatataaattgccaagtaata
aaaaacaaaaataatcacaatgaaagctataaccaaaattttgataaaacttatggggac
atatccttagagagaaatacattcttaactacaataaataaaaaatatttaaaacaaaat
acacaaccattattgaactattctgacgaaattcgaatgtgtagtagtggtgaaaatgga
aatgctggaaatgctgagaatggtgggaatgttgggaatagtggaaatgctggaaatgct
ggaaatgctgggaatagtggaaatgctgagaatgctggaaatgctggaaatgctggggat
gccggaaatgatgggaatgatggggatgatgggaatgcatggaaagataaaaaaaagtgt
gggaatgatgaggatgaaaatttgataaatgaaaaattgataaatgaaaatttgagaaat
gaaaataatgatgaagtggataacttatcaaaacaaatttatgatgataaaattaaaaat
aaaatagaagtaaatataaaacatgataatataattggaaataacaatgtaacaaataaa
acaaatgtaagtaacaatacaattggaaatatagatgggaataatataaaatatgatgta
tttcaaggagatgataaaatggtaattggtggaaattatgttaataataatatgaacaac
ccttttaatgttaataaaaatttaataatgggatctaagaattttaatttaacagcatct
ggaaaaacatatagaggaaataaaataaatgaatctggtaaaacaacaaatggaattatg
gttaaagaaaatgaagaagaatatagacatgatcatctaaataataataataataataat
attccgatttcaaatgatgggaaaaaagattttacaaaattagatggaatagatataaac
aatattggaaacaatccaaatgtttataatcaaataatggctagtcatatcaatcgtatg
aataataacaacaatgtaataataatgaaaaattttaaccccatcaattttcctataaat
tcacataactttaatatgataccaccatataataatgtaggaaatgtagggaatgtggga
aatgtaggaaatgtaggaaatatggggggcatgggtggcatgggtggcatgggaagcata
ataaataataacatcccaaacatcccaaacatcccaaacatcccaaacattccaaacata
caaaacattccaaacatctcaagcatctcaaacatacaaaacatccaaaacatcccaaac
atccaaaacatccaaaacatccaaaacatcccaaacaattttttaatgaatacacaaata
aatggaattaacaataattccttaaacgatataaatattacaaacccttctagtggtgta
attggtgttttaggaaatttatcttataataataatgtaatttcaaacaatatagatgga
aatttaaataaaaaaaattcgtcagcatttattgataaagataaaagtattaaagataat
gaaaattgcaaaaaaaataatattaaaaattcaaataataaaaatataaataatgttgaa
ggagagaataataaaaatacaataaaaaatattcgtatggaaaatttaaagtttaatgat
aatatagatttaaaaaatatagatggaatcgatttaagctcatattttgtaaatggaaaa
tattgctctaaattacctaatcatgaaaaaatatataatataatttattacattgttaat
aattcattacatgaatatttaactgacttttataatagtgaagatttggtatataaagaa
aaagacgaaaaagaagaaaacgaacaaaatgaagaggatgagaatgttttaaaaaatgaa
actacaaaatgtggagaagcaaacatattagattcagataaaaattcaaaaggggagcaa
aatatattattagaaaattctgaacaaataattgaaaaagaagaaaatamcaaaaataaa
agaaatgctgatgatattattgatgagaatgaaattgataaagaggatggaaatgatgat
aatacaatacgaaaaaaaaaaaaaataaaagttgaaaatgggaatgagaatgggaatgag
aatgaaaatggaaatggaaatggaaatggaaatgaaaatgaaaatcaaaatcaaaatcaa
aatcaaaataaaaatcaaaatgggaatggtggagtagatgcgccgtgtaaaaataaccaa
atagtagatgaagatggaaacaaaaaaagtggtaacataaataatgcagaaaattgcatg
agtaataataacaatatgaaaccagaaatgaaagataatgaaaataattatatattaggt
gaaataacaaaaagtatatgttctatattaaatttacaacaattaatgccagtaaataca
agattaaataattccggtttaatttatgatcctaattatgaaacaatatattcaaaatgg
aaactatttttaaaaaaagaacaatcaagtggaaatattatcagcaaatgtttttcacga
gattttttacatactgttttattatgtaattatgatagtataattgaagatttgaaaaaa
acagcagtaaaaaaaaaaataaaatatttttttcttcacatttgcttggaagcaaatctt
cctatcaatgttgcattgatgctctttttgaatgcaacaaagcagagcgacaagttgcag
tctctactgccatcagaaactggcttgggatatttgcatcgagatgctggaggagcaaaa
gaagaaaacatgggaattataacttttgaatgtataacaaatgatagagaacctgatcat
ttaattaaattaataacattaaaaaatatattttcaagacaattacctaaaatgcctaga
gaatatattgtgagattggtatttgatagaaatcattatacattttgtttacttaaaaaa
aatacagtaattggtggtgtttgttttagaccatattttgaacaaaagtttgctgaaatt
gcatttttagcagttacatcaacagagcaagttaaaggatatggaaccagacttatgaat
catttaaaagagcatgtcaaaaagtttggaattgaatattttctaacatatgcagataac
tttgccatcgggtattttagaaaacaggggttttcacaaaagatttcgatgccaaaagag
agatggtttgggtatataaaagattatgatggaggaacattaatggaatgttatatattt
ccaaatataaattatttaagattatctgaaatgttatatgaacaaaaaaaaacagtaaaa
aaggcaatacattttataaaaccccaaattatatttaaagggttaaattattttactgaa
aataaaggaggaaatttacaccctaataatattccaggcttattggaaattggatggaaa
aaagaatataaagatatgacaacaaaaaaaacacatcataaagaagttcaattaaaagat
caaattataaatgttcttgattatttggaaaaacaacaatctgcttggccttttttaaaa
ccagtcagcctttctgaagccccagattattatgacatcatcaaagaacccactgatatc
ttaacgatgcgaaggaaagcccgtcatggggaatataagacgaaggaagactttggaatt
gagttgaagaggatgtttgataactgccgattatacaatgcgccaacaacgatatacttt
aaatatgccaatgaattacaagccttaatctggcccaaatatgaagaaattagcgaaatg
gcaaagtaa

DBGET integrated database retrieval system