KEGG   Plasmodium yoelii: PY17X_0707600Help
Entry
PY17X_0707600     CDS       T01035                                 

Gene name
PY02679
Definition
(RefSeq) histone acetyltransferase GCN5
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PY17X_0707600 (PY02679)
Transcription machinery [BR:pyo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PY17X_0707600 (PY02679)
Chromosome [BR:pyo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    PY17X_0707600 (PY02679)
   HAT complexes
    PCAF complex
     PY17X_0707600 (PY02679)
    STAGA complex
     PY17X_0707600 (PY02679)
    TFTC complex
     PY17X_0707600 (PY02679)
    SAGA complex
     PY17X_0707600 (PY02679)
    SLIK complex
     PY17X_0707600 (PY02679)
    ADA-HAT complex
     PY17X_0707600 (PY02679)
    HAT-A2 complex
     PY17X_0707600 (PY02679)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Collagen FR47 Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 3829819
NCBI-ProteinID: XP_730595
Position
7
AA seq 1402 aa AA seqDB search
MECIVTNENSRFPPYHNFLKNENIYNYIDYIQIIGNIYYKYTEINDIINQIYIKRIGLLN
SVKNVKRNNPNFENLQINSKTKHVYPISIYKQDTLSITSINSDSINSDSTNSDSTNSDST
NSDSTNNWENVKSNINCQVIKNKNNHNESYNQNFDKTYGDISLERNTFLTTINKKYLKQN
TQPLLNYSDEIRMCSSGENGNAGNAENGGNVGNSGNAGNAGNAGNSGNAENAGNAGNAGD
AGNDGNDGDDGNAWKDKKKCGNDEDENLINEKLINENLRNENNDEVDNLSKQIYDDKIKN
KIEVNIKHDNIIGNNNVTNKTNVSNNTIGNIDGNNIKYDVFQGDDKMVIGGNYVNNNMNN
PFNVNKNLIMGSKNFNLTASGKTYRGNKINESGKTTNGIMVKENEEEYRHDHLNNNNNNN
IPISNDGKKDFTKLDGIDINNIGNNPNVYNQIMASHINRMNNNNNVIIMKNFNPINFPIN
SHNFNMIPPYNNVGNVGNVGNVGNVGNMGGMGGMGGMGSIINNNIPNIPNIPNIPNIPNI
QNIPNISSISNIQNIQNIPNIQNIQNIQNIPNNFLMNTQINGINNNSLNDINITNPSSGV
IGVLGNLSYNNNVISNNIDGNLNKKNSSAFIDKDKSIKDNENCKKNNIKNSNNKNINNVE
GENNKNTIKNIRMENLKFNDNIDLKNIDGIDLSSYFVNGKYCSKLPNHEKIYNIIYYIVN
NSLHEYLTDFYNSEDLVYKEKDEKEENEQNEEDENVLKNETTKCGEANILDSDKNSKGEQ
NILLENSEQIIEKEENNKNKRNADDIIDENEIDKEDGNDDNTIRKKKKIKVENGNENGNE
NENGNGNGNGNENENQNQNQNQNKNQNGNGGVDAPCKNNQIVDEDGNKKSGNINNAENCM
SNNNNMKPEMKDNENNYILGEITKSICSILNLQQLMPVNTRLNNSGLIYDPNYETIYSKW
KLFLKKEQSSGNIISKCFSRDFLHTVLLCNYDSIIEDLKKTAVKKKIKYFFLHICLEANL
PINVALMLFLNATKQSDKLQSLLPSETGLGYLHRDAGGAKEENMGIITFECITNDREPDH
LIKLITLKNIFSRQLPKMPREYIVRLVFDRNHYTFCLLKKNTVIGGVCFRPYFEQKFAEI
AFLAVTSTEQVKGYGTRLMNHLKEHVKKFGIEYFLTYADNFAIGYFRKQGFSQKISMPKE
RWFGYIKDYDGGTLMECYIFPNINYLRLSEMLYEQKKTVKKAIHFIKPQIIFKGLNYFTE
NKGGNLHPNNIPGLLEIGWKKEYKDMTTKKTHHKEVQLKDQIINVLDYLEKQQSAWPFLK
PVSLSEAPDYYDIIKEPTDILTMRRKARHGEYKTKEDFGIELKRMFDNCRLYNAPTTIYF
KYANELQALIWPKYEEISEMAK
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtattgtgaccaatgaaaatagtaggtttcctccttatcacaattttttaaaa
aatgaaaatatatacaactatatagattatattcaaattattggaaatatttattataaa
tataccgaaataaatgatattattaatcagatatacataaaaagaataggtctgttaaat
agtgtcaaaaatgtgaaaagaaataatccaaactttgaaaatcttcaaataaattcgaaa
acgaaacatgtgtatccaatatctatatataaacaagacaccttatctattacatctata
aatagtgattctataaatagtgattctacaaatagtgattcgacaaatagtgattctaca
aatagtgattctacaaataattgggaaaatgttaaatctaatataaattgccaagtaata
aaaaacaaaaataatcacaatgaaagctataaccaaaattttgataaaacttatggggac
atatccttagagagaaatacattcttaactacaataaataaaaaatatttaaaacaaaat
acacaaccattattgaactattctgacgaaattcgaatgtgtagtagtggtgaaaatgga
aatgctggaaatgctgagaatggtgggaatgttgggaatagtggaaatgctggaaatgct
ggaaatgctgggaatagtggaaatgctgagaatgctggaaatgctggaaatgctggggat
gccggaaatgatgggaatgatggggatgatgggaatgcatggaaagataaaaaaaagtgt
gggaatgatgaggatgaaaatttgataaatgaaaaattgataaatgaaaatttgagaaat
gaaaataatgatgaagtggataacttatcaaaacaaatttatgatgataaaattaaaaat
aaaatagaagtaaatataaaacatgataatataattggaaataacaatgtaacaaataaa
acaaatgtaagtaacaatacaattggaaatatagatgggaataatataaaatatgatgta
tttcaaggagatgataaaatggtaattggtggaaattatgttaataataatatgaacaac
ccttttaatgttaataaaaatttaataatgggatctaagaattttaatttaacagcatct
ggaaaaacatatagaggaaataaaataaatgaatctggtaaaacaacaaatggaattatg
gttaaagaaaatgaagaagaatatagacatgatcatctaaataataataataataataat
attccgatttcaaatgatgggaaaaaagattttacaaaattagatggaatagatataaac
aatattggaaacaatccaaatgtttataatcaaataatggctagtcatatcaatcgtatg
aataataacaacaatgtaataataatgaaaaattttaaccccatcaattttcctataaat
tcacataactttaatatgataccaccatataataatgtaggaaatgtagggaatgtggga
aatgtaggaaatgtaggaaatatggggggcatgggtggcatgggtggcatgggaagcata
ataaataataacatcccaaacatcccaaacatcccaaacatcccaaacattccaaacata
caaaacattccaaacatctcaagcatctcaaacatacaaaacatccaaaacatcccaaac
atccaaaacatccaaaacatccaaaacatcccaaacaattttttaatgaatacacaaata
aatggaattaacaataattccttaaacgatataaatattacaaacccttctagtggtgta
attggtgttttaggaaatttatcttataataataatgtaatttcaaacaatatagatgga
aatttaaataaaaaaaattcgtcagcatttattgataaagataaaagtattaaagataat
gaaaattgcaaaaaaaataatattaaaaattcaaataataaaaatataaataatgttgaa
ggagagaataataaaaatacaataaaaaatattcgtatggaaaatttaaagtttaatgat
aatatagatttaaaaaatatagatggaatcgatttaagctcatattttgtaaatggaaaa
tattgctctaaattacctaatcatgaaaaaatatataatataatttattacattgttaat
aattcattacatgaatatttaactgacttttataatagtgaagatttggtatataaagaa
aaagacgaaaaagaagaaaacgaacaaaatgaagaggatgagaatgttttaaaaaatgaa
actacaaaatgtggagaagcaaacatattagattcagataaaaattcaaaaggggagcaa
aatatattattagaaaattctgaacaaataattgaaaaagaagaaaataacaaaaataaa
agaaatgctgatgatattattgatgagaatgaaattgataaagaggatggaaatgatgat
aatacaatacgaaaaaaaaaaaaaataaaagttgaaaatgggaatgagaatgggaatgag
aatgaaaatggaaatggaaatggaaatggaaatgaaaatgaaaatcaaaatcaaaatcaa
aatcaaaataaaaatcaaaatgggaatggtggagtagatgcgccgtgtaaaaataaccaa
atagtagatgaagatggaaacaaaaaaagtggtaacataaataatgcagaaaattgcatg
agtaataataacaatatgaaaccagaaatgaaagataatgaaaataattatatattaggt
gaaataacaaaaagtatatgttctatattaaatttacaacaattaatgccagtaaataca
agattaaataattccggtttaatttatgatcctaattatgaaacaatatattcaaaatgg
aaactatttttaaaaaaagaacaatcaagtggaaatattatcagcaaatgtttttcacga
gattttttacatactgttttattatgtaattatgatagtataattgaagatttgaaaaaa
acagcagtaaaaaaaaaaataaaatatttttttcttcacatttgcttggaagcaaatctt
cctatcaatgttgcattgatgctctttttgaatgcaacaaagcagagcgacaagttgcag
tctctactgccatcagaaactggcttgggatatttgcatcgagatgctggaggagcaaaa
gaagaaaacatgggaattataacttttgaatgtataacaaatgatagagaacctgatcat
ttaattaaattaataacattaaaaaatatattttcaagacaattacctaaaatgcctaga
gaatatattgtgagattggtatttgatagaaatcattatacattttgtttacttaaaaaa
aatacagtaattggtggtgtttgttttagaccatattttgaacaaaagtttgctgaaatt
gcatttttagcagttacatcaacagagcaagttaaaggatatggaaccagacttatgaat
catttaaaagagcatgtcaaaaagtttggaattgaatattttctaacatatgcagataac
tttgccatcgggtattttagaaaacaggggttttcacaaaagatttcgatgccaaaagag
agatggtttgggtatataaaagattatgatggaggaacattaatggaatgttatatattt
ccaaatataaattatttaagattatctgaaatgttatatgaacaaaaaaaaacagtaaaa
aaggcaatacattttataaaaccccaaattatatttaaagggttaaattattttactgaa
aataaaggaggaaatttacaccctaataatattccaggcttattggaaattggatggaaa
aaagaatataaagatatgacaacaaaaaaaacacatcataaagaagttcaattaaaagat
caaattataaatgttcttgattatttggaaaaacaacaatctgcttggccttttttaaaa
ccagtcagcctttctgaagccccagattattatgacatcatcaaagaacccactgatatc
ttaacgatgcgaaggaaagcccgtcatggggaatataagacgaaggaagactttggaatt
gagttgaagaggatgtttgataactgccgattatacaatgcgccaacaacgatatacttt
aaatatgccaatgaattacaagccttaatctggcccaaatatgaagaaattagcgaaatg
gcaaagtaa

DBGET integrated database retrieval system