KEGG   Plasmodium yoelii: PY02707Help
Entry
PY02707           CDS       T01035                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pyo  Plasmodium yoelii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PY02707
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PY02707
   00620 Pyruvate metabolism
    PY02707
   00640 Propanoate metabolism
    PY02707
Enzymes [BR:pyo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PY02707
Lipid biosynthesis proteins [BR:pyo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PY02707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 951 aa AA seqDB search
MNNAEHNGVASKMDSSKIDNIDIDENIFLNSKSFPVNEAYEVDQNKFGGNNQIKDIKEYK
KMYEESIKNPELFWGDMAKNNLRWSKLFTKTYIGNFNKGNVSWFVNGKINACDNCVDRWV
EKHPNKTAIIWEKDTPNDYKKISYQKLLEKVCKIANLLKMYGVKKQDCVTIYLPMIPELI
YSMLACARIGAIHNVVFAGYSTRSLSERIVSSGSTILITSDFGLRGGKLTKLKNIADGAM
EMSGMIKTCIVFKNKTKRNDNNNNSILNSKSNNMYNTSNICSQGSSHFLQYYAVGNATHK
NNNDPSPNVYDSILHNDISNHIKEDTFDKKTENLNNCVTNNITGICSNSNHNDINLSSNN
DTNDVNLSKNNKIDKKGTKEKDIQTLNKLISKNTNINKKNQNKENGTYKELYNNNDQYII
DGKENKLTENGTQMNGHISYDNNMINCNQVNAFEHINDYNIHNGHANYEQNCKSKYDFDE
NICTLKEGRDINGSMLMKNMRPYCPIEYVDSEDFLSILYTSGSTGKPKGVTHTTAGYLLY
AFATSKYIFDIKDDDIFGCVADIGWVTGHTYVVYGPLLNGITTTLFSSIPTYPDCSRYWN
LIQTHKITQFYTAPTALRTLMKHGDYYIKNYDLSSCRILGSVGEPINPETWRWYYNVVGK
KKCVIVDTYWQTETGGIVIAPIPHLFKMKPGSASLPFFGIQLEILNSKTLEPLKGPNVCG
ILCIKSSWPGMLRTVYGNHNRLIKTYFEACPSYYFTGDGAYRDEDGYYWISGRIDDTLNV
SGHRLGAAEIEHALVQHSCISESAVVSFSHKVKGEGILCFVVKKLTSFQKYPECNGDNNN
NDELNNRSLLSSNDNIVQNHTHENYTDEKLIEELKLYVRKVIGPIATPDIICIVPDLPKT
RSGKIIRRILRAIAIGLNDYGDISTVSNYDVIEIIKNKFMESKEKRYGVAS
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgcggaacacaatggagttgcttcaaagatggattcatcaaaaattgataat
attgatatagatgaaaatattttccttaatagcaaatcatttccagtaaatgaagcatat
gaggtcgatcaaaataaatttggtggtaacaaccaaattaaagatataaaagaatataaa
aaaatgtatgaagagagtataaaaaaccctgagttattttggggtgatatggcaaaaaat
aatttaaggtggtctaaattatttactaagacatatattggcaattttaataaaggaaat
gttagctggtttgttaatgggaaaataaatgcctgtgataattgtgttgatagatgggtt
gaaaagcatcctaataagactgccattatatgggaaaaggatacaccaaatgattataaa
aaaataagttatcaaaaattattagaaaaagtttgtaaaattgctaatttattaaaaatg
tatggagttaaaaaacaagattgtgtaaccatttatttgccaatgataccggaattgata
tattctatgctagcatgcgctagaataggtgctatacataatgttgtttttgctggatat
tctactaggagtttatcagaaaggatagtcagttcaggatcaactattttaattactagc
gattttggtttaagaggcggtaaattaaccaaattaaaaaatattgccgatggggcaatg
gagatgtctggaatgatcaaaacgtgtatagtttttaaaaataaaacaaaaagaaatgat
aacaataataatagtatattaaatagtaaatcaaataatatgtataatacatctaatata
tgctctcaaggaagtagtcatttcttgcaatattacgcagttggaaatgcaacacataaa
aacaataatgatccaagcccaaatgtatatgatagtatattacataatgatatttccaat
catattaaagaagatacatttgataaaaaaactgagaatttaaataattgtgttacaaat
aatataacaggcatatgtagtaatagcaatcataatgatattaatttatcttctaataat
gatacgaatgatgtcaatttatccaaaaataataaaatcgataaaaagggtactaaagaa
aaagatatacaaacacttaataaattaatatcaaaaaataccaatataaataaaaaaaat
caaaacaaggaaaatggtacatataaagagttatataacaataatgatcagtatataata
gatggaaaggaaaataaattgactgaaaatgggacacaaatgaatggacatatttcatat
gataataatatgattaactgtaatcaagtaaacgcttttgaacatattaatgattataat
atacacaatggacacgccaattatgaacaaaattgtaaaagcaaatatgattttgatgaa
aatatatgtacactaaaagaaggtcgagatattaatggatcaatgttaatgaaaaatatg
agaccatattgcccaatagaatatgtagatagtgaagattttttatctatattatataca
tctggttctactgggaaacctaaaggtgtgactcatactactgcaggatatttattatat
gcatttgcaacatccaaatatatttttgatataaaagatgatgatatttttggttgtgtt
gctgatattggttgggtaacaggtcatacttatgtagtatatggaccattattaaatgga
ataacaaccactttattttcatctatacctacctatcctgattgtagtagatattggaac
ttaatacaaactcataaaataacgcaattttatacagcccctaccgcacttagaacttta
atgaaacatggtgattattatattaaaaattatgatttatcatcttgtagaatattagga
agtgtaggcgaacctataaacccagaaacatggagatggtattataatgttgttggaaaa
aaaaaatgtgtaattgtcgatacatattggcaaacagaaacagggggcattgtcattgca
cctataccacatttatttaaaatgaaaccgggatctgcttctttaccattttttggtata
caattagagatattaaattcaaaaacattagagccattaaagggtccaaatgtatgtggt
atattatgtataaaaagttcatggccaggtatgttaagaacagtttatggaaatcacaat
agattaattaaaacctattttgaagcatgccccagttattattttactggagatggtgca
tatagagatgaagatgggtattattggatatcaggaaggatagatgatacactaaatgta
tcaggtcatagattaggcgctgcagaaattgaacatgctttagttcaacattcatgtatt
tctgaatcagcagttgtatctttttctcataaagttaaaggggaaggtattctatgtttt
gtcgttaaaaaactcacaagttttcaaaaatatccagaatgtaatggtgataataataat
aatgatgaattaaataatcgatctctattaagttcaaatgacaacattgtacaaaatcat
actcatgaaaattataccgatgaaaagttaatagaagaattgaagctatacgttagaaaa
gttattggaccaattgctacaccagatataatatgtattgtccccgatttgccaaaaaca
agaagtggaaaaattataagaagaatattaagagctatagcaatcggattgaatgattat
ggagatatttcaactgtttcaaattatgatgttattgaaattattaaaaataaatttatg
gaatctaaggaaaaacgttatggcgtagcatcataa

DBGET integrated database retrieval system