KEGG   Plasmodium yoelii: PY02807Help
Entry
PY02807           CDS       T01035                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pyo  Plasmodium yoelii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PY02807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 153 aa AA seqDB search
MNLFKNKKDIDDDDFQANFVLPPGDKVKGEKLFKKHCKQCHSIAPDNSQSNSGFTSWGPS
LFNVYNRTAGMSKGNSPFQVSPDMETSGIIWNDVNLMRYMKNPKQFVEANIGMNFKGIAN
FQDRVDIVHYLKTLTYDDPHGQEIIKKMSNKSK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatttaaaaataaaaaggatatagatgatgatgattttcaagctaattttgta
ttgcccccgggagacaaagttaaaggtgaaaaactgttcaaaaaacattgtaaacaatgt
cattcaatagcaccagataatagtcaatctaattcgggatttaccagttgggggccttct
ttatttaatgtatataatagaacagcagggatgagtaaaggaaattcgccatttcaagtt
tcaccagatatggagacatccgggattatatggaatgatgtaaatttaatgagatatatg
aaaaatccaaaacagtttgttgaggcaaatattggtatgaactttaaaggaattgcaaat
tttcaagatagagttgacattgttcattatttaaaaacgctaacttatgatgaccctcat
ggacaagaaataataaaaaaaatgtccaataaatcaaaataa

DBGET integrated database retrieval system