KEGG   Plasmodium yoelii: PY17X_1412000Help
Entry
PY17X_1412000     CDS       T01035                                 

Gene name
PY02807
Definition
(RefSeq) cytochrome c2 precursor,putative
  KO
K08738  
cytochrome c
Organism
pyo  Plasmodium yoelii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PY17X_1412000 (PY02807)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
14
AA seq 153 aa AA seqDB search
MNLFKNKKDIDDDDFQANFVLPPGDKVKGEKLFKKHCKQCHSIAPDNSQSNSGFTSWGPS
LFNVYNRTAGMSKGNSPFQVSPDMETSGIIWNDVNLMRYMKNPKQFVEANIGMNFKGIAN
FQDRVDIVHYLKTLTYDDPHGQEIIKKMSNKSK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatttaaaaataaaaaggatatagatgatgatgattttcaagctaattttgta
ttgcccccgggagacaaagttaaaggtgaaaaactgttcaaaaaacattgtaaacaatgt
cattcaatagcaccagataatagtcaatctaattcgggatttaccagttgggggccttct
ttatttaatgtatataatagaacagcagggatgagtaaaggaaattcgccatttcaagtt
tcaccagatatggagacatccgggattatatggaatgatgtaaatttaatgagatatatg
aaaaatccaaaacagtttgttgaggcaaatattggtatgaactttaaaggaattgcaaat
tttcaagatagagttgacattgttcattatttaaaaacgctaacttatgatgaccctcat
ggacaagaaataataaaaaaaatgtccaataaatcaaaataa

DBGET integrated database retrieval system