KEGG   Plasmodium yoelii: PY02860Help
Entry
PY02860           CDS       T01035                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pyo  Plasmodium yoelii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 921 aa AA seqDB search
MKLSGSISDQYENYNYIMLLLLQSLYITTPYPGGFIESEEEFLNILRRNEIKEDKNKQKK
TRSIKDKHYKNIVNRNNYIPPGFVIYEKKLSEKIYLQIRKCGFSQTYFKLKNKNNNILDE
SGTIRDSFCDNTDILLQASNNANINNSIRLDKSGSSKIYDNVNENGKVKSLDSNNGYDNN
SNTYENDNNTCENNSNNKISNNESVSNSTYKTSSNNSNICLSNSSTSIENEKTDGEEKNV
VKENGSIELNVKSRENIFSEENIKHREIDSDNKKGKKKFIKYVTEKDLSKLYREYLNIIK
DKKKKDTILKDVKEKSSSLEKANESEMRLNMNIENVEKTEEGKKSIIKKVMMKPKENVKN
NEKIDEEKKKKRGTIEDKYNKYDYTIKSNFELLHRKVEWFYHWFIESASNIEYDCRWNVI
LPYIVFKQENTKNFSENNFIDSLNTYLNQERGIVGNKTDDKKNGCDNDEKIKNVGKRGFS
EMNSSVKRRDSKSKRAKKGEGNTNESGQIKNVVNVVSVGNAENGENGENGENAENKDVNK
IEMKETEYVLTREVVMQVINDTLNNKYEKEEEAYYSFHKKYDVVYLCSDLKNDENLLICD
KIESGKNCEIVKSKEESSGSVMNIVDAKKKIIIDQTKNKKGRRRSNSDSRQGNNKEDINK
EDTNEDVTEYLYYYYLFGLATTYTFFTFQFDRNRISQFLIFPPMQNKGLGMKVLEKIYHL
SIINSNIKEITVEDPAASFTHLRDIITIKICIDLNIINPTILYPDEYLKTKNIKKEHVEL
DKKKFIKVCKETNKQIIRMIETISLAGVLPYPAPLYIENEDKYVHLRKKEKKNENVNLVN
SMEYFEASDACKDVRIKIKKRIKSDYIGSLINKNTNCMSSDVFRDYVCLKRNAELAYIYH
LCEVKEELNKLWKKQCKVYYR
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgagtggttcaatatctgatcaatatgaaaattataattatattatgttattg
cttttgcaaagtttgtatattactaccccttatccaggagggtttattgaatctgaagaa
gaatttttaaatattttaagaagaaacgaaataaaagaagataaaaataaacaaaaaaaa
actagaagtataaaagataaacattataaaaatattgtaaatagaaataattatattcct
cctggttttgtaatatatgaaaaaaaacttagtgaaaaaatatatttgcaaataagaaaa
tgtggattttcacaaacatattttaaattaaaaaataaaaataataatatattggatgaa
tctggaactatacgtgattctttttgtgacaatactgatattttacttcaagcaagtaat
aatgcaaatattaataattctattagattagacaaatctgggtcgagtaaaatttatgat
aatgtgaatgaaaatgggaaggtaaaatctttagattctaataacggatatgataataat
agtaatacatatgaaaatgacaacaatacatgtgaaaataatagtaataataaaatttca
aacaatgaaagcgtttctaatagtacatataaaacttctagtaacaatagtaacatatgt
ttaagcaatagtagtacatctattgaaaatgaaaaaacagatggagaagaaaaaaatgtt
gttaaagagaatggaagtatcgaattaaatgttaaaagtagagagaatatattttcagaa
gagaatataaaacatcgagaaattgatagtgataataaaaaagggaaaaagaaatttata
aaatatgttacagaaaaagatttatcaaaattatatagagaatatttaaatatcataaaa
gataagaaaaaaaaagatactattttaaaagatgtgaaagaaaaatcaagtagtcttgaa
aaagcaaatgaatctgaaatgagattaaatatgaatatagaaaatgttgaaaaaacagaa
gaaggtaaaaaatcaattattaaaaaagtaatgatgaaaccaaaagaaaatgttaaaaat
aatgaaaaaatagatgaagaaaaaaaaaaaaaaagaggaacaatagaagataaatataat
aaatatgattatacaataaaatcaaattttgaattattacatcgaaaagtagaatggttt
tatcattggttcattgaaagtgcatctaacattgaatatgattgtcgttggaatgttatt
cttccatatatagtatttaaacaagaaaatacgaaaaattttagtgaaaataattttata
gattctctaaatacctatttaaatcaagaaagaggaattgttggaaacaaaacagatgat
aaaaaaaatggttgtgacaatgatgaaaaaataaaaaatgtcggaaaaagagggtttagt
gaaatgaattcaagcgtgaaaagaagagattctaagagtaagcgagctaaaaaaggtgaa
ggtaatacaaatgaaagtggtcagataaaaaatgttgtcaatgttgtcagtgttggcaat
gctgaaaatggtgaaaatggtgaaaatggtgaaaatgctgaaaataaagatgtcaacaaa
attgagatgaaagaaacagaatatgtacttacccgtgaggtagttatgcaagttattaat
gatacgttgaataataaatatgaaaaagaagaagaagcttattattcttttcataaaaaa
tatgatgttgtttatttatgttccgatttaaagaatgatgaaaatttattaatttgtgat
aaaattgaaagtggcaaaaattgcgaaatagtaaaatctaaagaagagagttcaggatct
gtaatgaatatagttgatgcaaaaaaaaaaataataatagatcaaacaaaaaataaaaaa
ggaagaagacgaagcaatagtgatagtcgacaaggaaataataaagaagatattaataaa
gaagatactaatgaagatgttacagaatatttatattattattatttatttggattagca
acaacatatacattttttacatttcaatttgatagaaatcgaatatctcaatttttaatt
tttccacctatgcaaaataaaggtttaggtatgaaggttttagaaaaaatttaccattta
tctattattaattctaatataaaagaaattactgttgaagatccagcagcatcttttaca
catttaagagatattataacaataaaaatatgtattgatttaaatattataaacccgact
atattatatcctgatgaatatttaaagacaaagaatatcaaaaaagaacatgtagaatta
gataaaaagaaatttataaaagtgtgtaaagaaactaataaacaaattatacgaatgatt
gaaaccatatctttagcgggtgttttaccatatcctgctcctttatatattgaaaatgaa
gataaatatgttcatcttcgaaaaaaagagaaaaaaaatgaaaatgtgaatttagtaaat
tcaatggaatatttcgaagcttcagatgcatgtaaagatgttcgaatcaaaattaaaaaa
cgaataaaaagcgactacattgggagtttgataaacaaaaatacaaactgcatgtctagt
gacgttttccgagattatgtatgcttaaagaggaatgccgaattggcttacatttatcac
ttgtgcgaagtaaaggaggagctaaacaagttgtggaagaagcagtgcaaagtatattac
aggtaa

DBGET integrated database retrieval system