KEGG   Plasmodium yoelii: PY17X_0718600Help
Entry
PY17X_0718600     CDS       T01035                                 

Gene name
PY02860
Definition
(RefSeq) histone acetyltransferase, putative
  KO
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PY17X_0718600 (PY02860)
Chromosome [BR:pyo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    PY17X_0718600 (PY02860)
   HAT complexes
    HATB complex
     PY17X_0718600 (PY02860)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
7
AA seq 1028 aa AA seqDB search
MKSEINNIDNVQESKYEDMDRDYYNCIKNCAADLQNLSLNFFPSINAYACIPKLNAINSI
TFHPCISTKDYFNNTYSFKPLFTHHFFSDSEQVIGFESLKIDFYYTCDNYEVYMKLSGSI
SDQYENYNYIMLLLLQSLYITTPYPGGFIESEEEFLNILRRNEIKEDKNKQKKTRSIKDK
HYKNIVNRNNYIPPGFVIYEKKLSEKIYLQIRKCGFSQTYFKLKNKNNNILDESGTIRDS
FCDNTDILLQASNNANINNSIRLDKSGSSKIYDNVNENGKVKSLDSNNGYDNNSNTYEND
NNTCENNSNNKISNNESVSNSTYKTSSNNSNICLSNSSTSIENEKTDGEEKNVVKENGSI
ELNVKSRENIFSEENIKHREIDSDNKKGKKKFIKYVTEKDLSKLYREYLNIIKDKKKKDT
ILKDVKEKSSSLEKANESEMRLNMNIENVEKTEEGKKSIIKKVMMKPKENVKNNEKIDEE
KKKKRGTIEDKYNKYDYTIKSNFELLHRKVEWFYHWFIESASNIEYDCRWNVILPYIVFK
QENTKNFSENNFIDSLNTYLNQERGIVGNKTDDKKNGCDNDEKIKNVGKRGFSEMNSSVK
RRDSKSKRAKKGEGNTNESGQIKNVVNVVSVGNAENGENGENGENAENKDVNKIEMKETE
YVLTREVVMQVINDTLNNKYEKEEEAYYSFHKKYDVVYLCSDLKNDENLLICDKIESGKN
CEIVKSKEESSGSVMNIVDAKKKIIIDQTKNKKGRRRSNSDSRQGNNKEDINKEDTNEDV
TEYLYYYYLFGLATTYTFFTFQFDRNRISQFLIFPPMQNKGLGMKVLEKIYHLSIINSNI
KEITVEDPAASFTHLRDIITIKICIDLNIINPTILYPDEYLKTKNIKKEHVELDKKKFIK
VCKETNKQIIRMIETISLAGVLPYPAPLYIENEDKYVHLRKKEKKNENVNLVNSMEYFEA
SDACKDVRIKIKKRIKSDYIGSLINKNTNCMSSDVFRDYVKEELNKLWKKQCKVYYRTIK
KLRSLYPL
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgagataaataatatagataatgtccaagaaagcaaatatgaggatatggat
agggactattataattgtataaaaaattgtgcagcagatttacaaaatttatcattaaat
ttttttccgtccattaatgcatatgcatgtattccaaaactgaatgctataaattcgatt
acgtttcatccttgtatttccactaaagattattttaataatacctattcttttaagcct
ttatttacccatcatttttttagcgacagtgagcaggtaatcgggttcgagtcgctgaaa
atcgatttttactatacatgtgataactatgaagtatacatgaaattgagtggttcaata
tctgatcaatatgaaaattataattatattatgttattgcttttgcaaagtttgtatatt
actaccccttatccaggagggtttattgaatctgaagaagaatttttaaatattttaaga
agaaacgaaataaaagaagataaaaataaacaaaaaaaaactagaagtataaaagataaa
cattataaaaatattgtaaatagaaataattatattcctcctggttttgtaatatatgaa
aaaaaacttagtgaaaaaatatatttgcaaataagaaaatgtggattttcacaaacatat
tttaaattaaaaaataaaaataataatatattggatgaatctggaactatacgtgattct
ttttgtgacaatactgatattttacttcaagcaagtaataatgcaaatattaataattct
attagattagacaaatctgggtcgagtaaaatttatgataatgtgaatgaaaatgggaag
gtaaaatctttagattctaataacggatatgataataatagtaatacatatgaaaatgac
aacaatacatgtgaaaataatagtaataataaaatttcaaacaatgaaagcgtttctaat
agtacatataaaacttctagtaacaatagtaacatatgtttaagcaatagtagtacatct
attgaaaatgaaaaaacagatggagaagaaaaaaatgttgttaaagagaatggaagtatc
gaattaaatgttaaaagtagagagaatatattttcagaagagaatataaaacatcgagaa
attgatagtgataataaaaaagggaaaaagaaatttataaaatatgttacagaaaaagat
ttatcaaaattatatagagaatatttaaatatcataaaagataagaaaaaaaaagatact
attttaaaagatgtgaaagaaaaatcaagtagtcttgaaaaagcaaatgaatctgaaatg
agattaaatatgaatatagaaaatgttgaaaaaacagaagaaggtaaaaaatcaattatt
aaaaaagtaatgatgaaaccaaaagaaaatgttaaaaataatgaaaaaatagatgaagaa
aaaaaaaaaaaaagaggaacaatagaagataaatataataaatatgattatacaataaaa
tcaaattttgaattattacatcgaaaagtagaatggttttatcattggttcattgaaagt
gcatctaacattgaatatgattgtcgttggaatgttattcttccatatatagtatttaaa
caagaaaatacgaaaaattttagtgaaaataattttatagattctctaaatacctattta
aatcaagaaagaggaattgttggaaacaaaacagatgataaaaaaaatggttgtgacaat
gatgaaaaaataaaaaatgtcggaaaaagagggtttagtgaaatgaattcaagcgtgaaa
agaagagattctaagagtaagcgagctaaaaaaggtgaaggtaatacaaatgaaagtggt
cagataaaaaatgttgtcaatgttgtcagtgttggcaatgctgaaaatggtgaaaatggt
gaaaatggtgaaaatgctgaaaataaagatgtcaacaaaattgagatgaaagaaacagaa
tatgtacttacccgtgaggtagttatgcaagttattaatgatacgttgaataataaatat
gaaaaagaagaagaagcttattattcttttcataaaaaatatgatgttgtttatttatgt
tccgatttaaagaatgatgaaaatttattaatttgtgataaaattgaaagtggcaaaaat
tgcgaaatagtaaaatctaaagaagagagttcaggatctgtaatgaatatagttgatgca
aaaaaaaaaataataatagatcaaacaaaaaataaaaaaggaagaagacgaagcaatagt
gatagtcgacaaggaaataataaagaagatattaataaagaagatactaatgaagatgtt
acagaatatttatattattattatttatttggattagcaacaacatatacattttttaca
tttcaatttgatagaaatcgaatatctcaatttttaatttttccacctatgcaaaataaa
ggtttaggtatgaaggttttagaaaaaatttaccatttatctattattaattctaatata
aaagaaattactgttgaagatccagcagcatcttttacacatttaagagatattataaca
ataaaaatatgtattgatttaaatattataaacccgactatattatatcctgatgaatat
ttaaagacaaagaatatcaaaaaagaacatgtagaattagataaaaagaaatttataaaa
gtgtgtaaagaaactaataaacaaattatacgaatgattgaaaccatatctttagcgggt
gttttaccatatcctgctcctttatatattgaaaatgaagataaatatgttcatcttcga
aaaaaagagaaaaaaaatgaaaatgtgaatttagtaaattcaatggaatatttcgaagct
tcagatgcatgtaaagatgttcgaatcaaaattaaaaaacgaataaaaagcgactacatt
gggagtttgataaacaaaaatacaaactgcatgtctagtgacgttttccgagattatgta
aaggaggagctaaacaagttgtggaagaagcagtgcaaagtatattacagaaccatcaaa
aagttgaggtcgctatatccactttaa

DBGET integrated database retrieval system