KEGG   Plasmodium yoelii: PY02906Help
Entry
PY02906           CDS       T01035                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pyo  Plasmodium yoelii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pyo00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 574 aa AA seqDB search
MSLHLSGYSLGLSQFIAKCILRHRGPDWNGIVVEENEDGTTNVLTHERLAIVDVLSGQQP
LYDDKKEICLTINGEIYNHLELRKLVKQDVLDALKSKSDCAVIPNLYKIYKEKLPSMLDG
IFAGVISDKKYNTFFAFRDPIGICPLYIGYASDGSIWFASEFKALRIHCVRYVTFPPGHY
YICNNGKGEFVRYYNPNWWKLDSPIPNSKIDLEKIRITLENAVIKRLMGDVPFGILLSGG
LDSSIIASIIARHLKSIQNDTNNNINGTCVGKNNKNLNTLKSFSIGLKGSPDLKAAKEVA
DFLNTDHTEFNFTVDQGIDSLHDVIYHIETYDITTIRASTPMYILSRLIKSSCIKMVLSG
EGSDEIFGGYLYFHKAPNAEEFHRELQRKIHDLHIYDVLRANKSTMAFGIEARVPFLDLE
FLDVVMNIDPQEKMCSNNKIEKDILRRAFAGYLPDHILYRQKEQFSDGVGYNWIDGLKEY
AEKKVSDSQFSRAPFLFPYNTPKTKEAYLYRCIFYQCFPEQCAQEFVPEGPSIACSTSKA
IEWDEQFKINPDQSGRYVLDVHKHSKNVEDIKAA
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgcacttatctggttatagtcttgggcttagtcaattcattgctaaatgcata
ttacgacaccgagggccagattggaatggtatagttgtcgaggaaaatgaagatggaaca
acaaatgtattaactcatgaaagattagcaattgtagatgtattatcagggcaacaacca
ttatatgatgacaaaaaagaaatatgtttaactattaatggagaaatatataatcattta
gaattaagaaaattagtaaaacaagatgttttagatgcattaaaaagtaaatcagattgt
gctgtaattccaaacttatataaaatatataaagaaaaattaccttctatgttagatggt
atatttgcgggagttattagtgataaaaaatataatacattttttgcatttagagatcct
ataggaatatgcccactttatataggttatgcatcagatggttcaatatggtttgcatct
gaatttaaagcgttaaggatacattgtgtaagatatgtaacatttccacctggtcattat
tatatttgtaataatggaaaaggtgaatttgttagatattataatccaaactggtggaaa
ttggatagtcctataccaaatagtaaaatagacttagaaaaaatacgtattactttagaa
aatgcagtaattaaaagattaatgggtgatgtaccatttggaattttattatctggtggt
ttagattcatctataattgcatctataattgcaagacatttaaaatcaatacaaaatgac
actaataataatattaatggaacatgtgtcggaaaaaataataaaaatttaaatacttta
aaaagtttttctattggattaaaaggttctcctgatttaaaagcagctaaagaagttgct
gattttttaaacacagatcatactgaatttaattttactgttgatcagggtattgattca
ttacatgatgttatatatcacattgaaacatatgacataacaactattcgtgcatctaca
cctatgtatattctttcaaggttaataaaaagtagttgtattaaaatggttttaagtggt
gaaggatctgatgagatatttggtggatatttatatttccataaagcaccaaatgcagaa
gaatttcatagagaattacaaaggaaaatacatgatttacatatttatgatgtcttacga
gcaaataaatctactatggcttttggtatagaagcacgagtaccatttttagatctcgaa
tttttagacgtagttatgaatatagatccacaagaaaaaatgtgttcaaataataaaatt
gaaaaagatattttaagaagagcttttgctggttatttacctgatcacatcctttacaga
caaaaggaacaattttccgatggtgttggttataattggattgatgggttaaaagaatat
gcagaaaaaaaagtatcagattctcaattttctagagcccctttcctttttccatataat
acacccaaaactaaagaagcctatttatatcgatgtatattttaccaatgttttcctgag
caatgtgctcaagaatttgtacccgagggtccatctatagcttgctctacaagcaaggca
attgaatgggatgaacagttcaaaataaatcctgaccagtcaggtagatatgttttagac
gtacacaagcattcaaaaaatgttgaggatataaaagccgcctaa

DBGET integrated database retrieval system