KEGG   Plasmodium yoelii: PY03083Help
Entry
PY03083           CDS       T01035                                 

Definition
FAD/NAD-binding cytochrome reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pyo  Plasmodium yoelii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PY03083
Enzymes [BR:pyo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PY03083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 356 aa AA seqDB search
MNYRISNMFAIFSSNFLMSIIVVTISIILVIWGKSKWNKKKELFLLYSKKHEYEEIDVKL
KSDENKKFLNGKNKTLKLKDVITLTDTVKIYIFSYPSEYDDFGLGICKHIKFSGLNIQGK
IKGKWNNNDDREKDLSEIFRSYTPVYINKKKKQIHFIIRIYKEDEHFIDGGKMSSQLDKL
RNKSKINITGPFGLIEYKGNNEFSYLSKSIKIKKHIVMIAGGTGMTPFFRLINHLLLTKK
TNIEDEPIYITFIYANRNEQEILLKPVFDEYDANFENFKKVYSIDKCLDSTLKDTVDNIG
YINIDLLKKYVLKYEKLNIPIKNSDTLVLTCGPPPMTSLLNVLLKEEMKMENVIIL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaggattagtaacatgtttgcaattttctcatcgaactttttaatgtcaata
atagttgtgactatttctataattttagttatttggggaaaaagtaaatggaataaaaag
aaagaattatttttgttatattctaaaaaacatgaatatgaagaaatagacgtaaaatta
aaaagtgatgaaaataaaaaatttttaaatggaaaaaataaaacattaaaattaaaggat
gtaataacattaacagatacagtaaaaatatatattttttcttatccaagtgaatatgac
gattttggtttggggatatgtaagcatataaaatttagtggcttaaatatacaaggaaaa
ataaaagggaaatggaataataatgatgatagagaaaaagatttatcggaaatttttaga
agttatacacctgtatatataaataaaaaaaaaaaacaaattcattttataattcgtata
tataaagaagatgaacattttatagatggtggaaaaatgagttctcaactggataaattg
cgaaataaaagtaaaataaatataacagggccatttggattaattgaatataaagggaat
aatgaattttcttatttgtcaaagtctattaaaattaaaaaacatatagttatgattgct
ggtggtactggaatgactccattttttcgattaataaatcatttgttattaacaaaaaag
acaaatatagaagacgagcctatttacataacctttatatatgcaaaccgaaatgagcaa
gaaattttacttaaaccagttttcgatgaatatgatgcaaattttgaaaacttcaaaaaa
gtttatagcatagacaaatgtttagatagtacactgaaagacactgttgataatatagga
tatataaatatagacttattaaaaaaatatgttttaaaatatgaaaaattaaatatacct
attaaaaatagcgatacactagttttaacatgcggccccccacctatgacatccttacta
aatgtgttattaaaagaagaaatgaaaatggaaaatgtcataattctttag

DBGET integrated database retrieval system