KEGG   Plasmodium yoelii: PY17X_1144700Help
Entry
PY17X_1144700     CDS       T01035                                 

Gene name
PY03083
Definition
(RefSeq) FAD/NAD-binding cytochrome reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pyo  Plasmodium yoelii
Pathway
pyo00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PY17X_1144700 (PY03083)
Enzymes [BR:pyo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PY17X_1144700 (PY03083)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 DcuC
Motif
Other DBs
NCBI-GeneID: 3830274
NCBI-ProteinID: XP_731048
UniProt: A0A078KCQ5
Position
11
AA seq 356 aa AA seqDB search
MNYRISNMFAIFSSNFLMSIIVVTISIILVIWGKSKWNKKKELFLLYSKKHEYEEIDVKL
KSDENKKFLNGKNKTLKLKDVITLTDTVKIYIFSYPSEYDDFGLGICKHIKFSGLNIQGK
IKGKWNNNDDREKDLSEIFRSYTPVYINKKKKQIHFIIRIYKEDEHFIDGGKMSSQLDKL
RNKSKINITGPFGLIEYKGNNEFSYLSKSIKIKKHIVMIAGGTGMTPFFRLINHLLLTKK
TNIEDEPIYITFIYANRNEQEILLKPVFDEYDANFENFKKVYSIDKCLDSTLKDTVDNIG
YINIDLLKKYVLKYEKLNIPIKNSDTLVLTCGPPPMTSLLNVLLKEEMKMENVIIL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaggattagtaacatgtttgcaattttctcatcgaactttttaatgtcaata
atagttgtgactatttctataattttagttatttggggaaaaagtaaatggaataaaaag
aaagaattatttttgttatattctaaaaaacatgaatatgaagaaatagacgtaaaatta
aaaagtgatgaaaataaaaaatttttaaatggaaaaaataaaacattaaaattaaaggat
gtaataacattaacagatacagtaaaaatatatattttttcttatccaagtgaatatgac
gattttggtttggggatatgtaagcatataaaatttagtggcttaaatatacaaggaaaa
ataaaagggaaatggaataataatgatgatagagaaaaagatttatcggaaatttttaga
agttatacacctgtatatataaataaaaaaaaaaaacaaattcattttataattcgtata
tataaagaagatgaacattttatagatggtggaaaaatgagttctcaactggataaattg
cgaaataaaagtaaaataaatataacagggccatttggattaattgaatataaagggaat
aatgaattttcttatttgtcaaagtctattaaaattaaaaaacatatagttatgattgct
ggtggtactggaatgactccattttttcgattaataaatcatttgttattaacaaaaaag
acaaatatagaagacgagcctatttacataacctttatatatgcaaaccgaaatgagcaa
gaaattttacttaaaccagttttcgatgaatatgatgcaaattttgaaaacttcaaaaaa
gtttatagcatagacaaatgtttagatagtacactgaaagacactgttgataatatagga
tatataaatatagacttattaaaaaaatatgttttaaaatatgaaaaattaaatatacct
attaaaaatagcgatacactagttttaacatgcggccccccacctatgacatccttacta
aatgtgttattaaaagaagaaatgaaaatggaaaatgtcataattctttag

DBGET integrated database retrieval system