KEGG   Plasmodium yoelii: PY03300Help
Entry
PY03300           CDS       T01035                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pyo  Plasmodium yoelii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PY03300
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PY03300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 315 aa AA seqDB search
METYIEKKQLDEGCMLSKKKNEAKKCEGQKNEGKKYEGQKNEASKNEASKNDASKNEASK
NDASKNDISSDTTQLISIDNPKSINNKNNGEGKKIIKGERIDKKNKEDNNFIIDDLEKQX
DKISMNILNILKASNIPNCDILKRTNNRFAKAFLYLTEGYKMSVKNVIKKSIYKRKYKNN
TLIKIKDIHVYSLCKHHLLPFEGLCDIEYNPDKYIMGLSKFSRITDIYARRLQLQEDLTN
DICNALKKYLKPLYIKVTIKAKHLCINMRGVKEHDAMTVTHASYVSKKNISCFKENINLS
KNEISKSDNHDQSLS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaaacctatatcgaaaaaaagcaactcgatgaaggttgcatgttaagcaagaaaaaa
aatgaagccaaaaaatgtgaaggccaaaaaaatgaaggcaaaaaatatgaaggccaaaaa
aatgaagccagcaaaaatgaagccagcaaaaatgacgccagcaaaaatgaagccagcaaa
aatgacgccagcaaaaatgacatttcaagcgatacaacacaattgataagtatagataat
cctaaatcgataaataataaaaataatggtgaaggtaaaaaaataataaaaggggaaaga
atagacaaaaagaataaggaggataataattttattatagacgatttagaaaaacaamca
gataaaataagtatgaatatattaaatattttaaaagcatcaaatattccaaattgtgat
atattaaaaagaacaaataacagatttgctaaagcatttttatatttaactgaaggatat
aaaatgagtgtaaaaaatgtaataaaaaaatctatatataaaagaaaatataaaaataat
acactaattaaaataaaagatatacatgtttattctttatgtaaacatcatttattgcca
tttgaaggattgtgtgatattgaatataatccagataaatatataatgggtttatccaaa
ttttcaagaattactgatatatatgcaagacgtttacaattgcaagaagatcttactaat
gatatttgcaatgctttaaaaaaatatttaaaacccttatatataaaagttacaattaaa
gctaaacatttatgcattaatatgagaggggtaaaagaacatgatgctatgacagttaca
catgcatcatatgtatcaaaaaaaaatattagttgttttaaagaaaatattaatttatcg
aaaaatgaaatatcaaaatcagataaccatgatcaatctttatcataa

DBGET integrated database retrieval system