KEGG   Plasmodium yoelii: PY03421Help
Entry
PY03421           CDS       T01035                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pyo  Plasmodium yoelii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pyo00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 463 aa AA seqDB search
MMNKYMNIIFFFFFVCATYVSSQADQIINERLDKFVFLSCNNHKKKPNFNLIKSIEKKKP
QLMLWIGDYFYSECRELKCLKEAYEYIKNDKYYINIKKKFTIDGIYDDHDYNCNNGDRLY
KYKKESKTMYLDYLGVDKNDIRYKRNGAYFSKLYIDPNDENNQVKIIILDTRYNKDPYPY
YSLESHTDGFISLVLSLLSRMHASLFGLYCNSPNDILGNEQWKWLEKEFTNSKARAHIVI
SSIQVFANFIINENWGLMPAALKRLKALIKKTKPKGLVFLSGDVHYGSIIGNEEDIVEVT
SSNINQENEFSPIINYFAYYISYLLNKKTPFKFDKIYGFSNYGEININYLDKNKINLKIS
INNSNGEEVMSANQYFNNQKDIYIXTKDIHLINDDFACLSCKSKSKVFMIFIAYILYILW
CLQICFIILKIILKIILKIIFYKKGAKDIHSSNKEDEVHKKNK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaagtatatgaatataatttttttttttttttttgtgtgtgcaacatatgtg
agttcccaggccgatcaaataattaacgaaagattagacaaattcgttttcttaagttgt
aataatcataaaaagaaacctaattttaatttaataaaatcaattgaaaaaaaaaaaccc
caattgatgctatggataggagattatttttattcagaatgcagagaacttaaatgtcta
aaagaagcatatgaatatattaaaaatgataaatattatataaatataaaaaaaaaattt
acaattgatggaatatatgatgatcatgattataattgtaacaatggagatcgtttatat
aaatataaaaaagaaagtaaaactatgtatttagattatttaggtgtagataaaaatgat
ataagatataaaagaaatggagcatatttttctaaattatatatagatccaaatgatgaa
aataatcaagttaaaattattattttagatacacgatataataaagatccatatccatat
tattctcttgaatcacatactgatggttttattagtttggttttatctttattatctcgt
atgcatgcatcattatttggactgtattgtaacagtcccaatgatatactaggaaatgaa
caatggaaatggttagaaaaggaatttactaattctaaagctcgtgctcacatagttata
tcatctatacaggtttttgccaattttataataaatgaaaattggggattaatgcccgcg
gccttaaagagactaaaagcattaataaaaaaaacaaaaccaaaagggttagtattttta
agtggtgatgtacattatggtagtataattggaaatgaggaagatattgttgaagtaaca
agtagtaatataaatcaggaaaatgaatttagtcctattattaattattttgcttattat
atttcatatttattaaataaaaaaacgccttttaaattcgataaaatatacggatttagt
aattacggtgaaattaatattaattatttagataaaaataaaataaatcttaaaatttcg
ataaataattcaaatggtgaagaagttatgtcagctaatcaatattttaataatcaaaaa
gatatatatatcamaacaaaagatattcatttaataaatgatgattttgcatgtttatca
tgtaaaagcaaatcaaaagtatttatgatttttattgcttatatattatatatattatgg
tgtcttcaaatctgtttcattattttaaaaattattttaaaaatcattttaaaaatcatt
ttctataaaaaaggtgcaaaagacatacatagtagtaataaggaagatgaagtacacaaa
aaaaataaataa

DBGET integrated database retrieval system