KEGG   Plasmodium yoelii: PY03802Help
Entry
PY03802           CDS       T01035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PY03802
Peptidases [BR:pyo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PY03802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1098 aa AA seqDB search
SVYQHKTKRKDKIIFKVDIQPLKIVVYSKDTNEHSNPPQMKIVILRSDTIENVLKEIISD
FDPKKFKKHLFYAEGIGENKETNWKCLYLSNSNDYPLNKKVYEYDIDEMSCLLITNERAD
IKCLTYDNEYSEYNMTSNNISGSVDDDTINNPKSISYIFENGGDRGLINLGNTCFLNSSL
QCLSKILKFTNYFLSGTFWDHINYCNPVGQHGRLAKAYYETLLEMWKINKKGKPYAPKVL
KQAISEKRDEFYGYQQHDSQELLAFLLDGLHEDLNLIQKKPYYEEKLQGGLDRPDIEVAE
ASWKRHKEINNSIIVDLFQGQYRSRLQCPQCNKLSITFDPFMYLSIPLPPKKNHRIWFHV
MLSRDVQISLRFSSIFSGSQEVLKLKYNFINIITNLKKKKNSILLHTKNIIKNNKYSHEN
TNAFNFHTKFMDDTYESYEINNEGSSGNSINNKNNIDGCNYMRALKNKSKIKNTLNEEDI
NNIYEHICHMCNINTIDDIEISNLFFLYTRFKNLACNNFFQILNNNDIIAEPHTRTGKGI
SHIFVFMVPQNWPHLTDNNKNGNNYNDDNGKIRTSDSLTSSTSSVGKARNANSKDEDMYI
KNDSPNSNDKKYIQNKLHNNKLAKKRKGSLSSPSNSLRKGDKLHLDNEIGKVDDLENSND
TITEYIKNELFNNDNKSLYLLIVPLCKDEQLLCKMKNNDLPFLVNTAYNITTRELYEKVK
NAYKKNSKFENIKMNQSRSNSINSGSYGNNHNGYGEKRLKNGDSEIGYYNENENNNKLYH
KNKNISNIYFDSNKKDNSPDISLNCSTNSTNLNIDESTNSYENKSTNDYYESYLDKIHLY
IPSYNLKDNWDAKDNLGFFLKCDETYLTDYIQISEQNKLIIIHLDTNSIKDELSVDIKTL
TLMDLEEKYSVDTCLKLFSEEEHLDEDNTWYCSNCKLHVQAYKKLDLFRMPIVLILHLKR
FNNSNRWLRTKIDSYVYYPHKENEYLDMTPYILPDGLKHMKSFDPNYLPLYELIGVNCHT
GGLGGGHYFAYVKLNGQWYNFNDTYVTTINESQINTKNAYLLFYQLHTYKNEKFTDIAHH
RNIAEEEAIRMANASYYN
NT seq 3298 nt NT seq  +upstreamnt  +downstreamnt
atcagtttatcaacataaaacgaaaagaaaagataaaataattttcaaagtcgacatcca
accgcttaaaattgttgtttattcaaaagatacaaatgagcactcaaacccccctcaaat
gaaaatcgttattttacgcagcgatactatagaaaatgttctaaaggagataatcagtga
ttttgatcccaaaaaatttaaaaaacatttattttatgcggaaggtataggagaaaataa
agaaacaaactggaaatgtttatacttaagtaatagcaatgattatcctttaaataaaaa
agtatatgaatatgatatagacgaaatgagttgtttattaataactaatgaaagggctga
tataaaatgcttaacatatgataatgaatatagtgaatataatatgacaagcaataatat
atcaggaagtgtagatgatgatacaataaataatcccaaatctattagttatatatttga
aaatggtggtgatagaggattaataaatttaggtaacacatgttttttaaattcatcatt
acaatgtttatcaaagattttaaaatttacaaattattttttaagtggaacattttggga
tcatataaattattgtaacccagttggacaacatggtcgactagctaaagcatattatga
aacattattagaaatgtggaaaataaataaaaaaggaaaaccatatgctcctaaagtttt
aaaacaagcaataagtgaaaagagagatgaattttatggatatcaacaacatgattcaca
agaacttttagcatttttattagatggtcttcatgaagatttaaatttaattcagaaaaa
accatattatgaagaaaaattacaaggagggttagatagaccagatatagaagttgcaga
agcatcatggaaaagacataaagaaattaacaattcaataattgttgatttatttcaagg
acaatatagatcgagattacagtgtcctcaatgtaataaacttagtataacatttgatcc
ttttatgtatttatcaattccattaccacctaaaaagaatcatagaatatggtttcatgt
tatgttaagtagagatgttcaaatttctttgagattttcttctatttttagtggttctca
agaagtgttaaaattaaaatataatttcataaacattataacaaatttaaaaaaaaaaaa
aaattctatacttttacatacaaaaaatattattaaaaataacaaatattctcatgaaaa
tacaaacgcttttaattttcataccaaatttatggatgacacatatgaaagttatgaaat
aaataatgagggaagttctgggaatagtataaataataaaaataatattgatgggtgtaa
ttatatgagagctttaaaaaataaatcaaaaataaaaaatacactaaatgaagaagatat
aaataatatatatgaacatatttgtcatatgtgtaatattaacacaatagatgatattga
aatttcaaatttattttttttatataccagatttaaaaatttagcatgtaataacttttt
tcaaatattgaataataatgatattattgctgaaccacacacaagaacaggaaaaggaat
tagtcatatatttgtttttatggttcctcaaaattggccacatttaactgataataataa
aaatggaaacaattataatgatgataatggaaaaataagaacatcggatagtttaacttc
ttcaacaagttcagttggaaaagcacgaaatgccaattcaaaagatgaggatatgtatat
aaaaaatgattcgccaaatagtaatgataaaaaatatattcaaaataaattacataataa
taagttagccaaaaaacggaaaggtagtttatcttcaccttcgaattctttaagaaaagg
agacaaattacatttagataatgaaatagggaaagtagatgatttagaaaattcaaatga
tactataactgaatatataaaaaatgaactctttaataatgataataaatctttatattt
gttaattgtgcctttatgtaaagatgaacaattattatgtaaaatgaaaaataatgattt
gccttttttagtaaatactgcatataatatcacaacaagggagttgtacgaaaaagtaaa
aaatgcatacaaaaaaaattcaaaatttgaaaacataaaaatgaatcaaagtagaagtaa
cagtattaatagtggatcttatggaaacaatcataatgggtatggagaaaaacgattaaa
aaatggcgatagtgaaataggatattataatgaaaatgaaaataataataaattatatca
taaaaataaaaatatatctaatatatattttgatagtaataaaaaagataatagtccaga
tatcagtttaaattgttcaactaatagtacaaatttaaatattgacgaaagtacaaattc
atatgaaaataaaagtaccaatgattattatgaaagctatttagataaaatacatttata
tataccttcttacaatttaaaagataattgggatgcaaaagataatttaggttttttttt
aaaatgtgatgaaacatatttaacagattatattcaaatttcagaacaaaataaacttat
tattatacatttagatactaattcaataaaagatgaattatctgttgatattaaaacatt
aacactaatggatttagaagaaaaatatagtgttgatacatgtttaaaattattttcaga
agaagaacatttagatgaagataatacatggtattgtagtaattgtaaattacatgtaca
agcatataaaaagttagatttatttagaatgccaattgtattaatcttacatctaaaaag
atttaataattcaaatagatggttaagaactaaaatagattcatatgtttattatcccca
taaagaaaatgaatatcttgatatgacaccatatatattaccagatggtttaaagcatat
gaaaagttttgatccaaattatttacctttatatgaactaataggagttaattgtcatac
tggcggtttgggtggtggtcattattttgcttatgttaaattaaatggacagtggtataa
ttttaatgatacatatgttacaacaattaatgaatctcaaattaacacaaaaaatgcata
tcttttattttaccaacttcatacttataaaaatgaaaagtttaccgatatagctcatca
tagaaacatagcagaagaagaggctattcgaatggcaaatgcaagttactataattaa

DBGET integrated database retrieval system