KEGG   Plasmodium yoelii: PY03877Help
Entry
PY03877           CDS       T01035                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pyo  Plasmodium yoelii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 447 aa AA seqDB search
MSNRKKVAYFHDPDIGSYYYGAGHPMKPQRIRMTHSLIVSYNLYKYMEVYRPHKSDVNEL
TLFHDYEYVDFLSSISMENYRDFTYQLKRFNVGEATDCPVFDGLFQFQQSCAGASIDGAA
KLNHHCADICVNWSGGLHHAKMSEASGFCYINDIVLGILELLKYHARVMYIDIDVHHGDG
VEEAFYVTHRVMTVSFHKFGDYFPGTGDITDVGVNHGKYYSVNVPLNDGITDEAFVDLFK
VVIDKCVQSYKPGAIILQCGADSLTGDRLGRFNLTIKGHARCVEHVRSYNLPLLVLGGGG
YTIRNVSRCWAYETGVVLNKHHEMSDQISLNDYYDYYAPDFQLHLQPSSIPNYNSPEHLN
KIKMKITENLRNIEHAPGVQFSYVPPDFFDSDIDDKSDKNQYELKDDSGGGRAAGTRGKE
HSSTHHLRRKNYEDDFFDMSDRDQGII
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatagaaaaaaagtagcatattttcatgaccctgatataggtagctattattat
ggagcgggtcatcctatgaagcctcaaagaattcgaatgacacattctttaattgtatca
tacaatttatataaatatatggaagtatataggcctcataaaagtgatgtaaatgagtta
actttatttcatgattatgaatatgttgattttttatcatcgatatctatggaaaattat
cgagattttacatatcaattaaaaagatttaatgttggagaagctactgattgcccagtt
tttgatggcctttttcaatttcagcaatcatgcgcaggtgcatcgattgatggagcagct
aaattaaatcaccattgtgccgatatttgcgtgaactggtcaggtggtttacatcacgca
aaaatgtcagaagctagtggattttgttatattaatgacattgttttaggcatattagaa
ttgctaaaatatcatgcacgtgttatgtatattgacattgatgttcatcatggagatgga
gttgaggaagctttttatgttactcatagagttatgactgtttcatttcataaatttggt
gattattttcctggtacaggtgatataacagatgtaggtgttaatcatggaaagtattat
agtgttaatgtgccattaaatgatggaataactgatgaagcatttgtagatttatttaaa
gttgttatagataaatgtgtccagtcttataaacctggtgctattatacttcaatgtggt
gcagatagtttaacgggtgatagattaggtcgatttaatttaactataaaaggtcatgca
agatgtgttgaacatgtccgttcatataatttaccattattagttttaggtggtggggga
tatacaatacgaaatgtatcaagatgttgggcatatgaaactggagttgttttaaataaa
catcatgaaatgtctgatcaaattagtttaaatgattattatgattattatgcacctgat
tttcaattgcatttacaaccatctagtataccaaattataattcacctgaacatttaaat
aaaattaaaatgaaaataacagaaaacttaagaaatattgaacatgctccaggagttcaa
ttttcttatgtaccccctgatttttttgattcagatatagatgataaaagtgataaaaat
caatatgaacttaaagatgatagtggaggtggtagagcagcaggaacgcgaggaaaagaa
cattcttctactcatcatttaagaagaaaaaattatgaagatgattttttcgatatgtca
gatagagatcaaggaattatttag

DBGET integrated database retrieval system